Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Tissue factor pathway inhibitor Recombinant Protein | TFPI1 recombinant protein

Recombinant Rabbit Tissue factor pathway inhibitor

Average rating 0.0
No ratings yet
Gene Names
TFPI; EPI; LACI
Reactivity
Rabbit
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Tissue factor pathway inhibitor; N/A; Recombinant Rabbit Tissue factor pathway inhibitor; Extrinsic pathway inhibitor; EPI; Lipoprotein-associated coagulation inhibitor; LACI; TFPI1 recombinant protein
Ordering
Host
Yeast
Reactivity
Rabbit
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer 50% glycerol
Sequence Positions
Full Length, 25-300a
Sequence
AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKE KCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNT CENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKY SGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT
Calculated MW
33.8 kDa
Immunogen Description
Expression Region:25-300a; Sequence Info:Full Length
Tag Info
N-terminal 6xHis-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.

Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.

Notes:Repeated freezing and thawing is not recommended.

Store working aliquots at 4°C for up to one week.
Related Product Information for TFPI1 recombinant protein
Inhibits factor X (X (a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tissue factor pathway inhibitor
NCBI Official Symbol
TFPI
NCBI Official Synonym Symbols
EPI; LACI
NCBI Protein Information
tissue factor pathway inhibitor
UniProt Protein Name
Tissue factor pathway inhibitor
UniProt Gene Name
TFPI
UniProt Synonym Gene Names
TFPI; EPI; LACI

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TFPI1 tfpi (Catalog #AAA309785) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 25-300a. The Recombinant Rabbit Tissue factor pathway inhibitor reacts with Rabbit and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: AAEEDEEFTN ITDIKPPLQK PTHSFCAMKV DDGPCRAYIK RFFFNILTHQ CEEFIYGGCE GNENRFESLE ECKE KCARD YPKMTTKLTF QKGKPDFCFL EEDPGICRGY ITRYFYNNQS KQCERFKYGG CLGNLNNFES LEECKNT CE NPTSDFQVDD HRTQLNTVNN TLINQPTKAP RRWAFHGPSW CLPPADRGLC QANEIRFFYN AIIGKCRPFK Y SGCGGNEN NFTSKKACIT ACKKGFIPKS IKGGLIKTKR KKKKQPVKIT YVETFVKKT. It is sometimes possible for the material contained within the vial of "Tissue factor pathway inhibitor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.