Uncharacterized protein (TG) Recombinant Protein | TG recombinant protein

Recombinant Gorilla Uncharacterized protein (TG), partial

Cat. Num. AAA114270

• Gene Names: TG; TGN; AITD3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Uncharacterized protein (TG); N/A; Recombinant Gorilla Uncharacterized protein (TG), partial; TG recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2503-2771aa; Partial
• Sequence: LRVEVDLLIGSSQEDGLINRAKAVKQFEESQGRTSSKTAFYQALQNSLGGEDSDARVEAAATWYYSLEHSTDDYASFSRALENATRDYFIICPIIDMASAWAKRARGNVFMYHVPESYGHGSLELLADVQFAFGLPFYPAYEGQFSLEEKSLSLKIMQYFSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSALLPNRQGLKKADCSFWSKYISSLKASADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKSYSK

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for TG recombinant protein

Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).

Product Categories/Family for TG recombinant protein

Metabolism

References

Primary structure of human thyroglobulin deduced from the sequence of its 8448-base complementary DNA.Malthiery Y., Lissitzky S.Eur. J. Biochem. 165:491-498(1987) The revised 8307 base pair coding sequence of human thyroglobulin transiently expressed in eukaryotic cells.van de Graaf S.A.R., Pauws E., de Vijlder J.J.M., Ris-Stalpers C.Eur. J. Endocrinol. 136:508-515(1997) DNA sequence and analysis of human chromosome 8.Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T., Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.Nature 439:331-335(2006) Sequence of the 5'-end quarter of the human-thyroglobulin messenger ribonucleic acid and of its deduced amino-acid sequence.Malthiery Y., Lissitzky S.Eur. J. Biochem. 147:53-58(1985) Structural organization of the 5' region of the thyroglobulin gene. Evidence for intron loss and 'exonization' during evolution.Parma J., Christophe D., Pohl V., Vassart G.J. Mol. Biol. 196:769-779(1987) An unusually long poly(purine) -poly(pyrimidine) sequence is located upstream from the human thyroglobulin gene.Christophe D., Cabrer B., Bacolla A., Targovnik H.M., Pohl V., Vassart G.Nucleic Acids Res. 13:5127-5144(1985) Genomic organization of the 5' region of the human thyroglobulin gene.Moya C.M., Mendive F.M., Rivolta C.M., Vassart G., Targovnik H.M.Eur. J. Endocrinol. 143:789-798(2000) Genomic organization of the 3' region of the human thyroglobulin gene.Mendive F.M., Rivolta C.M., Vassart G., Targovnik H.M.Thyroid 9:903-912(1999) Identification of a minor Tg mRNA transcript in RNA from normal and goitrous thyroids.Targovnik H.M., Cochaux P., Corach D., Vassart G.Mol. Cell. Endocrinol. 84:R23-R26(1992) Hormone synthesis in human thyroglobulin possible cleavage of the polypeptide chain at the tyrosine donor site.Marriq C., Lejeune P.J., Venot N., Vinet L.FEBS Lett. 242:414-418(1989) Preferential sites of proteolytic cleavage of bovine, human and rat thyroglobulin. The use of limited proteolysis to detect solvent-exposed regions of the primary structure.Gentile F., Salvatore G.Eur. J. Biochem. 218:603-621(1993) Characterization of hormonogenic sites in an N-terminal, cyanogen bromide fragment of human thyroglobulin.Xiao S., Pollock H.G., Taurog A., Rawitch A.B.Arch. Biochem. Biophys. 320:96-105(1995) Glycosylation in human thyroglobulin location of the N-linked oligosaccharide units and comparison with bovine thyroglobulin.Yang S.X., Pollock H.G., Rawitch A.B.Arch. Biochem. Biophys. 327:61-70(1996) Characterization of the type-1 repeat from thyroglobulin, a cysteine-rich module found in proteins from different families.Molina F., Bouanani M., Pau B., Granier C.Eur. J. Biochem. 240:125-133(1996) Consensus sequences for early iodination and hormonogenesis in human thyroglobulin.Lamas L., Anderson P.C., Fox J.W., Dunn J.T.J. Biol. Chem. 264:13541-13545(1989) Sulfated tyrosines of thyroglobulin are involved in thyroid hormone synthesis.Nlend M.-C., Cauvi D., Venot N., Chabaud O.Biochem. Biophys. Res. Commun. 262:193-197(1999) The hormonogenic tyrosine 5 of porcine thyroglobulin is sulfated.Venot N., Nlend M.-C., Cauvi D., Chabaud O.Biochem. Biophys. Res. Commun. 298:193-197(2002) A single chondroitin 6-sulfate oligosaccharide unit at Ser-2730 of human thyroglobulin enhances hormone formation and limits proteolytic accessibility at the carboxyl terminus. Potential insights into thyroid homeostasis and autoimmunity.Conte M., Arcaro A., D'Angelo D., Gnata A., Mamone G., Ferranti P., Formisano S., Gentile F.J. Biol. Chem. 281:22200-22211(2006) Thyroglobulin gene point mutation associated with non-endemic simple goitre.Corral J., Martin C., Perez R., Sanchez I., Mories M.T., San Millan J.L., Miralles J.M., Gonzalez-Sarmiento R.Lancet 341:462-464(1993) Two novel cysteine substitutions (C1263R and C1995S) of thyroglobulin cause a defect in intracellular transport of thyroglobulin in patients with congenital goiter and the variant type of adenomatous goiter.Hishinuma A., Takamatsu J., Ohyama Y., Yokozawa T., Kanno Y., Kuma K., Yoshida S., Matsuura N., Ieiri T.J. Clin. Endocrinol. Metab. 84:1438-1444(1999) Amino acid substitutions in the thyroglobulin gene are associated with susceptibility to human and murine autoimmune thyroid disease.Ban Y., Greenberg D.A., Concepcion E., Skrabanek L., Villanueva R., Tomer Y.Proc. Natl. Acad. Sci. U.S.A. 100:15119-15124(2003) A novel compound heterozygous mutation in the thyroglobulin gene resulting in congenital goitrous hypothyroidism with high serum triiodothyronine levels.Kitanaka S., Takeda A., Sato U., Miki Y., Hishinuma A., Ieiri T., Igarashi T.J. Hum. Genet. 51:379-382(2006) Congenital hypothyroidism with goitre caused by new mutations in the thyroglobulin gene.Caputo M., Rivolta C.M., Esperante S.A., Gruneiro-Papendieck L., Chiesa A., Pellizas C.G., Gonzalez-Sarmiento R., Targovnik H.M.Clin. Endocrinol. (Oxf.) 67:351-357(2007) Thyroglobulin gene mutations producing defective intracellular transport of thyroglobulin are associated with increased thyroidal type 2 iodothyronine deiodinase activity.Kanou Y., Hishinuma A., Tsunekawa K., Seki K., Mizuno Y., Fujisawa H., Imai T., Miura Y., Nagasaka T., Yamada C., Ieiri T., Murakami M., Murata Y.J. Clin. Endocrinol. Metab. 92:1451-1457(2007) The p.A2215D thyroglobulin gene mutation leads to deficient synthesis and secretion of the mutated protein and congenital hypothyroidism with wide phenotype variation.Pardo V., Vono-Toniolo J., Rubio I.G., Knobel M., Possato R.F., Targovnik H.M., Kopp P., Medeiros-Neto G.J. Clin. Endocrinol. Metab. 94:2938-2944(2009)

NCBI and Uniprot Product Information

• NCBI GI #: 55770862
• NCBI GeneID: 7038
• NCBI Accession #: NP_003226.4
• NCBI GenBank Nucleotide #: NM_003235.4
• UniProt Accession #: P01266; O15274; O43899; Q15593; Q15948; Q9NYR1; Q9NYR2; Q9UMZ0; Q9UNY3
• Molecular Weight: 57.4kD
• NCBI Official Full Name: thyroglobulin
• NCBI Official Synonym Full Names: thyroglobulin
• NCBI Official Symbol: TG
• NCBI Official Synonym Symbols: TGN; AITD3
• NCBI Protein Information: thyroglobulin
• UniProt Protein Name: Thyroglobulin
• UniProt Gene Name: TG
• UniProt Synonym Gene Names: Tg
• UniProt Entry Name: THYG_HUMAN