Application Data
(Recombinant Mouse TGF-alpha/TGFA stimulates cell proliferation assay using Balb3T3 mouse fibroblast cells. The ED<sub>50</sub> for this effect is 0.43-1.72 ng/mL, corresponding to a specific activity of 15.81×10<sup>5</sup>~2.33×10<sup>6</sup> units/mg.)
TGF-alpha Recombinant Protein | TGF-alpha/TGFA recombinant protein
Recombinant Mouse TGF-alpha Protein
Synonyms
TGF-alpha; N/A; Recombinant Mouse TGF-alpha Protein; Protransforming growth factor alpha, Cleaved into: Transforming growth factor alpha, TGF-alpha, EGF-like TGF, ETGF, TGF type 1, Tgfa; TGF-alpha/TGFA recombinant protein
Host
HEK293 cells
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
SPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLA
Species
Mouse
Tag
C-hFc
Endotoxin
<0.1EU/ug of the protein by LAL method.
Bio-Activity
Measured in a cell proliferation assay using Balb3T3 mouse fibroblast cells. The ED50 for this effect is 0.43-1.72ng/mL, corresponding to a specific activity of 15.81×105~2.33×106 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
Application Data
(Recombinant Mouse TGF-alpha/TGFA stimulates cell proliferation assay using Balb3T3 mouse fibroblast cells. The ED<sub>50</sub> for this effect is 0.43-1.72 ng/mL, corresponding to a specific activity of 15.81×10<sup>5</sup>~2.33×10<sup>6</sup> units/mg.)
Application Data
(Recombinant Mouse TGF-alpha/TGFA stimulates cell proliferation assay using Balb3T3 mouse fibroblast cells. The ED<sub>50</sub> for this effect is 0.43-1.72 ng/mL, corresponding to a specific activity of 15.81×10<sup>5</sup>~2.33×10<sup>6</sup> units/mg.)
SDS-PAGE
(Recombinant Mouse TGF-alpha/TGFA Protein was determined by SDS-PAGE with Coomassie Blue, showing bands at 32-35,40 kDa.)
SDS-PAGE
(Recombinant Mouse TGF-alpha/TGFA Protein was determined by SDS-PAGE with Coomassie Blue, showing bands at 32-35,40 kDa.)
Related Product Information for TGF-alpha/TGFA recombinant protein
Transforming growth factor alpha (TGF-alpha) is a protein that in humans is encoded by the TGFA gene. TGF-alpha is a member of the EGF family of cytokines that are synthesized as transmembrane precursors and are characterized by the presence of one or several EGF structural units in their extracellular domain. Expression of TGF-alpha is widespread in tumors and transformed cells. TGF-alpha is also expressed in normal tissues during embryogenesis and in adult tissues, including pituitary, brain, keratinocytes, and macrophages.TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
Product Categories/Family for TGF-alpha/TGFA recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Protransforming growth factor alpha
UniProt Gene Name
Tgfa
UniProt Synonym Gene Names
TGF-alpha; ETGF
Similar Products
Product Notes
The TGF-alpha/TGFA tgfa (Catalog #AAA283351) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SPVAAAVVSH FNKCPDSHTQ YCFHGTCRFL VQEEKPACVC HSGYVGVRCE HADLLA. It is sometimes possible for the material contained within the vial of "TGF-alpha, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.