SDS-PAGE
Transforming growth factor beta-1 (TGFB1) Recombinant Protein | TGFB1 recombinant protein
Recombinant Dog Transforming growth factor beta-1 (TGFB1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transforming growth factor beta-1 (TGFB1); N/A; Recombinant Dog Transforming growth factor beta-1 (TGFB1); Recombinant Transforming growth factor beta-1 (TGFB1); Transforming growth factor beta-1; TGF-beta-1 Cleaved into the following chain: 1. Latency-associated peptide; 2. LAP; TGFB1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
279-390. Partial,provide Transforming growth factor beta-1 chain
Sequence
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
SDS-PAGE
SDS-PAGE
Related Product Information for TGFB1 recombinant protein
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts .
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kD
NCBI Official Full Name
transforming growth factor beta-1
NCBI Official Symbol
TGFB1
NCBI Protein Information
transforming growth factor beta-1; TGF-beta-1; transforming growth factor beta 1; transforming growth factor-beta 1; transforming growth factor, beta 1 (Camurati-Engelmann disease)
UniProt Protein Name
Transforming growth factor beta-1
UniProt Gene Name
TGFB1
UniProt Synonym Gene Names
TGF-beta-1; LAP
UniProt Entry Name
TGFB1_CANFA
Similar Products
Product Notes
The TGFB1 tgfb1 (Catalog #AAA113587) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 279-390. Partial,provide Transforming growth factor beta-1 chain. The amino acid sequence is listed below: ALDTNYCFSS TEKNCCVRQL YIDFRKDLGW KWIHEPKGYH ANFCLGPCPY IWSLDTQYSK VLALYNQHNP GASAAPCCVP QALEPLPIVY YVGRKPKVEQ LSNMIVRSCK CS. It is sometimes possible for the material contained within the vial of "Transforming growth factor beta-1 (TGFB1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.