Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Transforming Growth Factor-Beta 2 Recombinant Protein | TGF b 2 recombinant protein

Recombinant Human Transforming Growth Factor-Beta 2

Gene Names
TGFB2; LDS4; TGF-beta2
Purity
Greater than 97.0% as determined by SDS-PAGE.
Synonyms
Transforming Growth Factor-Beta 2; N/A; Recombinant Human Transforming Growth Factor-Beta 2; TGFB2 Human; Transforming Growth Factor Beta 2 Human Recombinant; Transforming growth factor; beta 2; cetermin; Glioblastoma-derived T-cell suppressor factor; polyergin; G-TSF; TGF-beta2; TGF-beta-2; transforming growth factor beta-2; BSC-1 cell growth inhibitor; TGFB-2; TGF b 2 recombinant protein
Ordering
Host
Nicotiana benthamiana
Purity/Purification
Greater than 97.0% as determined by SDS-PAGE.
Form/Format
Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS
Sequence Length
442
Solubility
It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M-cm H2O not less than 1 ug/40 ul, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution TGFB2 Human should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Related Product Information for TGF b 2 recombinant protein
Description: TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.

Introduction: TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-beta (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing.
Product Categories/Family for TGF b 2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,573 Da
NCBI Official Full Name
transforming growth factor beta-2 isoform 1
NCBI Official Synonym Full Names
transforming growth factor, beta 2
NCBI Official Symbol
TGFB2
NCBI Official Synonym Symbols
LDS4; TGF-beta2
NCBI Protein Information
transforming growth factor beta-2; BSC-1 cell growth inhibitor; G-TSF; cetermin; glioblastoma-derived T-cell suppressor factor; polyergin; prepro-transforming growth factor beta-2
UniProt Protein Name
Transforming growth factor beta-2
UniProt Gene Name
TGFB2
UniProt Synonym Gene Names
TGF-beta-2; G-TSF; LAP
UniProt Entry Name
TGFB2_HUMAN

Similar Products

Product Notes

The TGF b 2 tgfb2 (Catalog #AAA38206) is a Recombinant Protein produced from Nicotiana benthamiana and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: HHHHHH ALDAAYCFRN VQDNCCLRPL YIDFKRDLGW KWIHEPKGYN ANFCAGACPY LWSSDTQHSR VLSLYNTINP EASASPCCVS QDLEPLTI LYYIGKTPKI EQLSNMIVKS CKCS. It is sometimes possible for the material contained within the vial of "Transforming Growth Factor-Beta 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.