SDS-PAGE
Thrombospondin-2 Recombinant Protein | Thbs2 recombinant protein
Recombinant Mouse Thrombospondin-2 (Thbs2), partial
Gene Names
Thbs2; TSP2; Thbs-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thrombospondin-2; N/A; Recombinant Mouse Thrombospondin-2 (Thbs2), partial; Thbs2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-232. Partial
Sequence
GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Thbs2 recombinant protein
Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties.
References
Characterization of mouse thrombospondin 2 sequence and expression during cell growth and development.Laherty C.D., O'Rourke K., Wolf F.W., Katz R., Seldin M.F., Dixit V.M.J. Biol. Chem. 267:3274-3281(1992) Genomic sequence analysis in the mouse t-complex region.Brathwaite M., Waeltz P., Qian Y., Dudekula D., Schlessinger D., Nagaraja R. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.A second, expressed thrombospondin gene (Thbs2) exists in the mouse genome.Bornstein P., O'Rourke K., Wikstrom K., Wolf F.W., Katz R., Li P., Dixit V.M.J. Biol. Chem. 266:12821-12824(1991) The antiangiogenic effect of thrombospondin-2 is mediated by CD36 and modulated by histidine-rich glycoprotein.Simantov R., Febbraio M., Silverstein R.L.Matrix Biol. 24:27-34(2005)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26.1 kDa
NCBI Official Full Name
thrombospondin-2
NCBI Official Synonym Full Names
thrombospondin 2
NCBI Official Symbol
Thbs2
NCBI Official Synonym Symbols
TSP2; Thbs-2
NCBI Protein Information
thrombospondin-2
UniProt Protein Name
Thrombospondin-2
UniProt Gene Name
Thbs2
UniProt Synonym Gene Names
Tsp2
UniProt Entry Name
TSP2_MOUSE
Similar Products
Product Notes
The Thbs2 thbs2 (Catalog #AAA116194) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-232. Partial. The amino acid sequence is listed below: GDHVKDTSFD LFSISNINRK TIGAKQFRGP DPGVPAYRFV RFDYIPPVNT DDLNRIVKLA RRKEGFFLTA QLKQDRKSRG TLLVLEGPGT SQRQFEIVSN GPGDTLDLNY WVEGNQHTNF LEDVGLADSQ WKNVTVQVAS DTYSLYVGCD LIDSVTLEEP FYEQLEVDRS RMYVAKGASR ESHFRGLLQN VHLVFADSVE DILSKKGCQH SQGA. It is sometimes possible for the material contained within the vial of "Thrombospondin-2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.