TLN1 recombinant protein
Recombinant Human TLN1 Protein
Gene Names
TLN1; TLN; ILWEQ
Applications
SDS-Page, ELISA, Western Blot
Purity
> 90% as determined by SDS-PAGE
Synonyms
TLN1; N/A; Recombinant Human TLN1 Protein; ILWEQ; TLN; TLN1 recombinant protein
Host
E Coli
Purity/Purification
> 90% as determined by SDS-PAGE
Form/Format
20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, with 10% glycerol.
Concentration
0.2 mg/mL (varies by lot)
Sequence
MLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEITGTLR
KDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFF
YSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPH
NEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLAR
SLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIK
RWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDII
Sequence Length
2541
Applicable Applications for TLN1 recombinant protein
SDS-PAGE, ELISA, WB (Western Blot)
Source
Human
Protein residues
with N-terminal GST-tagged.
Predicted MW
62.8 kDa
Observed MW
63 kDa
ENDOTOXIN LEVEL
Please contact us for more information.
USAGE
TLN1 Protein-Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
Avoid repeated freeze-thaw cycles.
The recombinant protein is stable for up to 6 months from date of receipt at -80°C.
The recombinant protein is stable for up to 6 months from date of receipt at -80°C.
Related Product Information for TLN1 recombinant protein
TLN1 is a high-molecular-weight cytoskeletal protein concentrated at regions of cell-substratum contactand, in lymphocytes, at cell-cell contacts. Talin-1 is a cytoskeletal protein which is concentrated in areas of cell-substratum and cell-cell contacts. Thi s protein plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. It codistributes with integrins in the cell surface membrane in order to assist in the attachment of adherent cells to extracellular matrices and of lymphocytes to other cells. The N-terminus of this protein contains elements for localization to cell-extracellular matrix junctions. The C-terminus contains binding sites for proteins such as beta-1-integrin, actin, and vinculin.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28kDa
NCBI Official Full Name
talin-1
NCBI Official Synonym Full Names
talin 1
NCBI Official Symbol
TLN1
NCBI Official Synonym Symbols
TLN; ILWEQ
NCBI Protein Information
talin-1
UniProt Protein Name
Talin-1
UniProt Gene Name
TLN1
UniProt Synonym Gene Names
KIAA1027; TLN
UniProt Entry Name
TLN1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The TLN1 tln1 (Catalog #AAA55972) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TLN1 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the TLN1 tln1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLDGTVKTIM VDDSKTVTDM LMTICARIGI TNHDEYSLVR ELMEEKKEEI TGTLR KDKT LLRDEKKMEK LKQKLHTDDE LNWLDHGRTL REQGVEEHET LLLRRKFF Y SDQNVDSRDP VQLNLLYVQA RDDILNGSHP VSFDKACEFA GFQCQIQFGP H NEQKHKAG FLDLKDFLPK EYVKQKGERK IFQAHKNCGQ MSEIEAKVRY VKLAR SLKT YGVSFFLVKE KMKGKNKLVP RLLGITKECV MRVDEKTKEV IQEWNLTNIK RWAASPKSF TLDFGDYQDG YYSVQTTEGE QIAQLIAGYI DII. It is sometimes possible for the material contained within the vial of "TLN1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.