Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113283_SDS_PAGE15.jpg SDS-PAGE

Toll-like receptor 7 Recombinant Protein | Tlr7 recombinant protein

Recombinant Mouse Toll-like receptor 7

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Toll-like receptor 7; N/A; Recombinant Mouse Toll-like receptor 7; Tlr7 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-348. Provide the fragment of the extracellular domain at the N-terminal.
Sequence
FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS
Sequence Length
348
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA113283_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Tlr7 recombinant protein
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
References
Molecular cloning of murine Toll-like receptor 7.Heil F.J., Lipford G.B., Wagner H., Bauer S.M. Innate antiviral responses by means of TLR7-mediated recognition of single-stranded RNA.Diebold S.S., Kaisho T., Hemmi H., Akira S., Reis e Sousa C.Science 303:1529-1531(2004) The interaction between the ER membrane protein UNC93B and TLR3, 7, and 9 is crucial for TLR signaling.Brinkmann M.M., Spooner E., Hoebe K., Beutler B., Ploegh H.L., Kim Y.M.J. Cell Biol. 177:265-275(2007) UNC93B1 delivers nucleotide-sensing toll-like receptors to endolysosomes.Kim Y.M., Brinkmann M.M., Paquet M.E., Ploegh H.L.Nature 452:234-238(2008)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40.8 kDa
NCBI Official Full Name
toll-like receptor 7 isoform a
NCBI Official Synonym Full Names
toll-like receptor 7
NCBI Official Symbol
Tlr7
NCBI Protein Information
toll-like receptor 7
UniProt Protein Name
Toll-like receptor 7
UniProt Gene Name
Tlr7
UniProt Entry Name
TLR7_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Tlr7 tlr7 (Catalog #AAA113283) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-348. Provide the fragment of the extracellular domain at the N-terminal. The amino acid sequence is listed below: FRWFPKTLPC EVKVNIPEAH VIVDCTDKHL TEIPEGIPTN TTNLTLTINH IPSISPDSFR RLNHLEEIDL RCNCVPVLLG SKANVCTKRL QIRPGSFSGL SDLKALYLDG NQLLEIPQDL PSSLHLLSLE ANNIFSITKE NLTELVNIET LYLGQNCYYR NPCNVSYSIE KDAFLVMRNL KVLSLKDNNV TAVPTTLPPN LLELYLYNNI IKKIQENDFN NLNELQVLDL SGNCPRCYNV PYPCTPCENN SPLQIHDNAF NSLTELKVLR LHSNSLQHVP PTWFKNMRNL QELDLSQNYL AREIEEAKFL HFLPNLVELD FS. It is sometimes possible for the material contained within the vial of "Toll-like receptor 7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.