Transmembrane 4 L6 family member 4 Recombinant Protein | TM4SF4 recombinant protein
Recombinant Human Transmembrane 4 L6 family member 4
Gene Names
TM4SF4; ILTMP; il-TMP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transmembrane 4 L6 family member 4; N/A; Recombinant Human Transmembrane 4 L6 family member 4; Intestine and liver tetraspan membrane protein; IL-TMP; TM4SF4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-202aa; Full Length
Sequence
MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMIFPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKCLMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVNGLLGTLCGDCQCCGCCGGDGPV
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for TM4SF4 recombinant protein
Regulates the adhesive and proliferative status of intestinal epithelial cells. Can mediate density-dependent cell proliferation.
Product Categories/Family for TM4SF4 recombinant protein
References
A tetraspan membrane glycoprotein produced in the human intestinal epithelium and liver that can regulate cell density-dependent proliferation.Wice B.M., Gordon J.I.J. Biol. Chem. 270:21907-21918(1995)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37.38kD
NCBI Official Full Name
transmembrane 4 L6 family member 4
NCBI Official Synonym Full Names
transmembrane 4 L six family member 4
NCBI Official Symbol
TM4SF4
NCBI Official Synonym Symbols
ILTMP; il-TMP
NCBI Protein Information
transmembrane 4 L6 family member 4
UniProt Protein Name
Transmembrane 4 L6 family member 4
UniProt Gene Name
TM4SF4
UniProt Synonym Gene Names
ILTMP; IL-TMP
UniProt Entry Name
T4S4_HUMAN
Similar Products
Product Notes
The TM4SF4 tm4sf4 (Catalog #AAA113964) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-202aa; Full Length. The amino acid sequence is listed below: MCTGGCARCL GGTLIPLAFF GFLANILLFF PGGKVIDDND HLSQEIWFFG GILGSGVLMI FPALVFLGLK NNDCCGCCGN EGCGKRFAMF TSTIFAVVGF LGAGYSFIIS AISINKGPKC LMANSTWGYP FHDGDYLNDE ALWNKCREPL NVVPWNLTLF SILLVVGGIQ MVLCAIQVVN GLLGTLCGDC QCCGCCGGDG PV. It is sometimes possible for the material contained within the vial of "Transmembrane 4 L6 family member 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
