Bax inhibitor 1 (TMBIM6) Recombinant Protein | TMBIM6 recombinant protein
Recombinant Human Bax inhibitor 1 (TMBIM6)
Gene Names
TMBIM6; BI-1; TEGT; BAXI1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bax inhibitor 1 (TMBIM6); N/A; Recombinant Human Bax inhibitor 1 (TMBIM6); TMBIM6 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-237aa; Full Length
Sequence
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for TMBIM6 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32,711 Da
NCBI Official Full Name
bax inhibitor 1 isoform 2
NCBI Official Synonym Full Names
transmembrane BAX inhibitor motif containing 6
NCBI Official Symbol
TMBIM6
NCBI Official Synonym Symbols
BI-1; TEGT; BAXI1
NCBI Protein Information
bax inhibitor 1
UniProt Protein Name
Bax inhibitor 1
UniProt Gene Name
TMBIM6
UniProt Synonym Gene Names
BI1; TEGT; BI-1
UniProt Entry Name
BI1_HUMAN
Similar Products
Product Notes
The TMBIM6 tmbim6 (Catalog #AAA230759) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-237aa; Full Length. The amino acid sequence is listed below: MNIFDRKINF DALLKFSHIT PSTQQHLKKV YASFALCMFV AAAGAYVHMV THFIQAGLLS ALGSLILMIW LMATPHSHET EQKRLGLLAG FAFLTGVGLG PALEFCIAVN PSILPTAFMG TAMIFTCFTL SALYARRRSY LFLGGILMSA LSLLLLSSLG NVFFGSIWLF QANLYVGLVV MCGFVLFDTQ LIIEKAEHGD QDYIWHCIDL FLDFITVFRK LMMILAMNEK DKKKEKK. It is sometimes possible for the material contained within the vial of "Bax inhibitor 1 (TMBIM6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.