Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA134225_AD11.jpg Application Data

Tumor Necrosis Factor Alpha (TNFa) Recombinant Protein | TNFa recombinant protein

Recombinant Tumor Necrosis Factor Alpha (TNFa)

Average rating 0.0
No ratings yet
Gene Names
Tnf; Tnfa; RATTNF; TNF-alpha
Applications
Immunoprecipitation, ELISA, Western Blot, SDS-Page
Purity
> 95%
Synonyms
Tumor Necrosis Factor Alpha (TNFa); N/A; Recombinant Tumor Necrosis Factor Alpha (TNFa); TNFa recombinant protein
Ordering
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and T7-tag, its sequence is listed below.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-L RSSSQNSSDK PVAHVVANHQ AEEQLEWLSQ RANALLANGM DLKDNQLVVP ADGLYLIYSQ VLFKGQGCPD YVLLTHTVSR FAISYQEKVS LLSAIKSPCP KDTPEGAELK PWYEPMYLGG VFQLEKGDLL SAEVNLPKYL DITESGQVYF GVIAL
Sequence Length
235
Applicable Applications for TNFa recombinant protein
IP (Immunoprecipitation), ELISA, WB (Western Blot), SDS-PAGE
Organism
Rattus norvegicus (Rat)
Expression System
Prokaryotic expression
Residues
Leu80~Leu235 (Accession # P16599) with two N-terminal Tags, His-tag and T7-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

Application Data

product-image-AAA134225_AD11.jpg Application Data

SDS-PAGE

product-image-AAA134225_SDS_PAGE13.jpg SDS-PAGE

Sequence

product-image-AAA134225_SEQUENCE15.jpg Sequence

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21.0kDa
NCBI Official Full Name
tumor necrosis factor
NCBI Official Synonym Full Names
tumor necrosis factor
NCBI Official Symbol
Tnf
NCBI Official Synonym Symbols
Tnfa; RATTNF; TNF-alpha
NCBI Protein Information
tumor necrosis factor; cachectin; tumor necrosis factor alpha; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor ligand superfamily member 2
UniProt Protein Name
Tumor necrosis factor
UniProt Gene Name
Tnf
UniProt Synonym Gene Names
Tnfa; Tnfsf2; TNF-a; NTF; ICD1; ICD2
UniProt Entry Name
TNFA_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TNFa tnf (Catalog #AAA134225) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Tumor Necrosis Factor Alpha (TNFa) can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), ELISA, WB (Western Blot), SDS-PAGE. Researchers should empirically determine the suitability of the TNFa tnf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and T7-tag, its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-L RSSSQNSSDK PVAHVVANHQ AEEQLEWLSQ RANALLANGM DLKDNQLVVP ADGLYLIYSQ VLFKGQGCPD YVLLTHTVSR FAISYQEKVS LLSAIKSPCP KDTPEGAELK PWYEPMYLGG VFQLEKGDLL SAEVNLPKYL DITESGQVYF GVIAL. It is sometimes possible for the material contained within the vial of "Tumor Necrosis Factor Alpha (TNFa), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.