Troponin T, slow skeletal muscle (TNNT1) Recombinant Protein | TNNT1 recombinant protein
Recombinant Bovine Troponin T, slow skeletal muscle (TNNT1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Troponin T, slow skeletal muscle (TNNT1); N/A; Recombinant Bovine Troponin T, slow skeletal muscle (TNNT1); TNNT1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-263, full length protein
Sequence
MSDAEEQEYEEEQPEEEEAAEEEEEAPEEPEPAAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDHMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK
Sequence Length
263
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for TNNT1 recombinant protein
This gene encodes a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. Multiple transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,166 Da
NCBI Official Full Name
troponin T, slow skeletal muscle
NCBI Official Synonym Full Names
troponin T1, slow skeletal type
NCBI Official Symbol
TNNT1
NCBI Protein Information
troponin T, slow skeletal muscle
UniProt Protein Name
Troponin T, slow skeletal muscle
UniProt Gene Name
TNNT1
UniProt Synonym Gene Names
TnTs; sTnT
Similar Products
Product Notes
The TNNT1 tnnt1 (Catalog #AAA116858) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-263, full length protein. The amino acid sequence is listed below: MSDAEEQEYE EEQPEEEEAA EEEEEAPEEP EPAAEPEEER PKPSRPVVPP LIPPKIPEGE RVDFDDIHRK RMEKDLLELQ TLIDVHFEQR KKEEEELVAL KERIERRRAE RAEQQRFRTE KERERQAKLA EEKMRKEEEE AKKRAEDDAK KKKVLSNMGA HFGGYLVKAE QKRGKRQTGR EMKLRILSER KKPLNIDHMG EEQLREKAQE LSDWIHQLES EKFDLMAKLK QQKYEINVLY NRISHAQKFR KGAGKGRVGG RWK. It is sometimes possible for the material contained within the vial of "Troponin T, slow skeletal muscle (TNNT1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.