Tumor protein D55 (TPD52L3) Recombinant Protein | TPD52L3 recombinant protein
Recombinant Human Tumor protein D55 (TPD52L3)
Gene Names
TPD52L3; D55; hD55; NYDSP25
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor protein D55 (TPD52L3); N/A; Recombinant Human Tumor protein D55 (TPD52L3); TPD52L3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-140, Full length protein
Sequence
MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATFRSFEGLMGTIKSKVSGGKRAWP
Sequence Length
140
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for TPD52L3 recombinant protein
This gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,644 Da
NCBI Official Full Name
tumor protein D55 isoform 2
NCBI Official Synonym Full Names
tumor protein D52 like 3
NCBI Official Symbol
TPD52L3
NCBI Official Synonym Symbols
D55; hD55; NYDSP25
NCBI Protein Information
tumor protein D55
UniProt Protein Name
Tumor protein D55
UniProt Gene Name
TPD52L3
UniProt Synonym Gene Names
hD55
Similar Products
Product Notes
The TPD52L3 tpd52l3 (Catalog #AAA117588) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-140, Full length protein. The amino acid sequence is listed below: MPHARTETSV GTYESHSTSE LEDLTEPEQR ELKTKLTKLE AEIVTLRHVL AAKERRCGEL KRKLGLTALV GLRQNLSKSW LDVQVSNTYV KQKTSAALST MGTLICRKLG GVKKSATFRS FEGLMGTIKS KVSGGKRAWP. It is sometimes possible for the material contained within the vial of "Tumor protein D55 (TPD52L3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.