Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA81611_SDS_PAGE15.jpg SDS-PAGE

Thiopurine S-methyltransferase (TPMT) Recombinant Protein | TPMT recombinant protein

Recombinant Human Thiopurine S-methyltransferase (TPMT), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thiopurine S-methyltransferase (TPMT); N/A; Recombinant Human Thiopurine S-methyltransferase (TPMT), partial; Thiopurine methyltransferase; TPMT recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
4-244aa; Partial
Sequence
TRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTE
Sequence Length
245
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA81611_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for TPMT recombinant protein
Catalyzes the S-methylation of thiopurine drugs such as 6-mercaptopurine.
Product Categories/Family for TPMT recombinant protein
References
Human thiopurine methyltransferase molecular cloning and expression of T84 colon carcinoma cell cDNA.Honchel R., Aksoy I.A., Szumlanski C., Wood T.C., Otterness D.M., Wieben E.D., Weinshilboum R.M.Mol. Pharmacol. 43:878-887(1993) Thiopurine methyltransferase pharmacogenetics. Cloning of human liver cDNA and a processed pseudogene on human chromosome 18q21.1.Lee D., Szumlanski C.L., Houtman J., Honchel R., Rojas K., Overhauser J., Weiben E.D., Weinshilboum R.M.Drug Metab. Dispos. 23:398-405(1995) Thiopurine methyltransferase pharmacogenetics human gene cloning and characterization of a common polymorphism.Szumlanski C., Otterness D., Her C., Lee D., Brandriff B., Kelsell D., Spurr N., Lennard L., Wieben E., Weinshilboum R.M.DNA Cell Biol. 15:17-30(1996) Promoter and intronic sequences of the human thiopurine S-methyltransferase (TPMT) gene isolated from a human PAC1 genomic library.Krynetski E.Y., Fessing M.Y., Yates C.R., Sun D., Schuetz J.D., Evans W.E.Pharm. Res. 14:1672-1678(1997) Human thiopurine methyltransferase pharmacogenetics gene sequence polymorphisms.Otterness D., Szumlanski C., Lennard L., Klemetsdal B., Aarbakke J., Park-Hah J.O., Iven H., Schmiegelow K., Branum E., O'Brien J., Weinshilboum R.M.Clin. Pharmacol. Ther. 62:60-73(1997) Genomic structure of thiopurine S-methyltransferase gene.Nakamura Y.The DNA sequence and analysis of human chromosome 6.Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.Nature 425:805-811(2003) Detection of known and new mutations in the thiopurine S-methyltransferase gene by single-strand conformation polymorphism analysis.Spire-Vayron de la Moureyre C., Debuysere H., Sabbagh N., Marez D., Vinner E., Chevalier E.D., Lo-Guidice J.-M., Broly F.3.0.CO;2-E>Hum. Mutat. 12:177-185(1998) Structural basis of substrate recognition in thiopurine s-methyltransferase.Peng Y., Feng Q., Wilk D., Adjei A.A., Salavaggione O.E., Weinshilboum R.M., Yee V.C.Biochemistry 47:6216-6225(2008) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.Proteomics 8:1346-1361(2008) Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.Sci. Signal. 2:RA46-RA46(2009) Lysine acetylation targets protein complexes and co-regulates major cellular functions.Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.Science 325:834-840(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Structural basis of allele variation of human thiopurine-S-methyltransferase.Wu H., Horton J.R., Battaile K., Allali-Hassani A., Martin F., Zeng H., Loppnau P., Vedadi M., Bochkarev A., Plotnikov A.N., Cheng X.Proteins 67:198-208(2007) A single point mutation leading to loss of catalytic activity in human thiopurine S-methyltransferase.Krynetski E.Y., Schuetz J.D., Galpin A.J., Pui C.-H., Relling M.V., Evans W.E.Proc. Natl. Acad. Sci. U.S.A. 92:949-953(1995) Thiopurine S-methyltransferase deficiency two nucleotide transitions define the most prevalent mutant allele associated with loss of catalytic activity in Caucasians.Tai H.-L., Krynetski E.Y., Yates C.R., Loennechen T., Fessing M.Y., Krynetskaia N.F., Evans W.E.Am. J. Hum. Genet. 58:694-702(1996) Azathioprine-induced severe pancytopenia due to a homozygous two-point mutation of the thiopurine methyltransferase gene in a patient with juvenile HLA-B27-associated spondylarthritis.Leipold G., Schuetz E., Haas J.P., Oellerich M.Arthritis Rheum. 40:1896-1898(1997) Enhanced proteolysis of thiopurine S-methyltransferase (TPMT) encoded by mutant alleles in humans (TPMT*3A, TPMT*2) mechanisms for the genetic polymorphism of TPMT activity.Tai H.-L., Krynetski E.Y., Schuetz E.G., Yanishevski Y., Evans W.E.Proc. Natl. Acad. Sci. U.S.A. 94:6444-6449(1997) Thiopurine methyltransferase alleles in British and Ghanaian populations.Ameyaw M.-M., Collie-Duguid E.S.R., Powrie R.H., Ofori-Adjei D., McLeod H.L.Hum. Mol. Genet. 8:367-370(1999) Polymorphism of the thiopurine S-methyltransferase gene in African-Americans.Hon Y.Y., Fessing M.Y., Pui C.-H., Relling M.V., Krynetski E.Y., Evans W.E.Hum. Mol. Genet. 8:371-376(1999) The frequency and distribution of thiopurine methyltransferase alleles in Caucasian and Asian populations.Collie-Duguid E.S.R., Pritchard S.C., Powrie R.H., Sludden J., Collier D.A., Li T., McLeod H.L.Pharmacogenetics 9:37-42(1999) Genetic analysis of thiopurine methyltransferase polymorphism in a Japanese population.Hiratsuka M., Inoue T., Omori F., Agatsuma Y., Mizugaki M.Mutat. Res. 448:91-95(2000) Thiopurine S-methyltransferase pharmacogenetics variant allele functional and comparative genomics.Salavaggione O.E., Wang L., Wiepert M., Yee V.C., Weinshilboum R.M.Pharmacogenet. Genomics 15:801-815(2005) Severe azathioprine-induced myelotoxicity in a kidney transplant patient with thiopurine S-methyltransferase-deficient genotype (TPMT*3A/*3C) .Kurzawski M., Dziewanowski K., Ciechanowski K., Drozdzik M.Transpl. Int. 18:623-625(2005) Molecular analysis of thiopurine S-methyltransferase alleles in Taiwan aborigines and Taiwanese.Lu H.-F., Shih M.-C., Chang Y.-S., Chang J.-Y., Ko Y.-C., Chang S.-J., Chang J.-G.J. Clin. Pharm. Ther. 31:93-98(2006) Frequency of the thiopurine S-methyltransferase alleles in the ancient genetic population isolate of Sardinia.Rossino R., Vincis C., Alves S., Prata M.J., Macis M.D., Nucaro A.L., Schirru E., Congia M.J. Clin. Pharm. Ther. 31:283-287(2006) +Additional computationally mapped references.<p>Provides general information on the entry.

NCBI and Uniprot Product Information

NCBI GeneID
Molecular Weight
54.7 kDa
NCBI Official Synonym Full Names
thiopurine S-methyltransferase
NCBI Official Symbol
TPMT
NCBI Protein Information
thiopurine S-methyltransferase
UniProt Protein Name
Thiopurine S-methyltransferase
UniProt Gene Name
TPMT
UniProt Entry Name
TPMT_HUMAN

Similar Products

Product Notes

The TPMT tpmt (Catalog #AAA81611) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 4-244aa; Partial. The amino acid sequence is listed below: TRTSLDIEEY SDTEVQKNQV LTLEEWQDKW VNGKTAFHQE QGHQLLKKHL DTFLKGKSGL RVFFPLCGKA VEMKWFADRG HSVVGVEISE LGIQEFFTEQ NLSYSEEPIT EIPGTKVFKS SSGNISLYCC SIFDLPRTNI GKFDMIWDRG ALVAINPGDR KCYADTMFSL LGKKFQYLLC VLSYDPTKHP GPPFYVPHAE IERLFGKICN IRCLEKVDAF EERHKSWGID CLFEKLYLLT E. It is sometimes possible for the material contained within the vial of "Thiopurine S-methyltransferase (TPMT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.