Triggering receptor expressed on myeloid cells 2 (TREM2) Recombinant Protein | TREM2 recombinant protein
Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial
Gene Names
TREM2; TREM-2; Trem2a; Trem2b; Trem2c
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Triggering receptor expressed on myeloid cells 2 (TREM2); N/A; Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial; Triggering receptor expressed on monocytes 2; TREM2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-174. Partial, provide the complete extracellular domain.
Sequence
HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for TREM2 recombinant protein
May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.
Product Categories/Family for TREM2 recombinant protein
References
"Inflammatory responses can be triggered by TREM-1, a novel receptor expressed on neutrophils and monocytes." Bouchon A., Dietrich J., Colonna M. J. Immunol. 164:4991-4995(2000)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19.4 kDa
NCBI Official Full Name
triggering receptor expressed on myeloid cells 2 isoform 2
NCBI Official Synonym Full Names
triggering receptor expressed on myeloid cells 2
NCBI Official Symbol
TREM2
NCBI Official Synonym Symbols
TREM-2; Trem2a; Trem2b; Trem2c
NCBI Protein Information
triggering receptor expressed on myeloid cells 2
UniProt Protein Name
Triggering receptor expressed on myeloid cells 2
UniProt Gene Name
TREM2
UniProt Synonym Gene Names
TREM-2
UniProt Entry Name
TREM2_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The TREM2 trem2 (Catalog #AAA117000) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-174. Partial, provide the complete extracellular domain. The amino acid sequence is listed below: HNTTVFQGVA GQSLQVSCPY DSMKHWGRRK AWCRQLGEKG PCQRVVSTHN LWLLSFLRRW NGSTAITDDT LGGTLTITLR NLQPHDAGLY QCQSLHGSEA DTLRKVLVEV LADPLDHRDA GDLWFPGESE SFEDAHVEHS ISRSLLEGEI PFPPTS. It is sometimes possible for the material contained within the vial of "Triggering receptor expressed on myeloid cells 2 (TREM2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
