Tetraspanin-8 (TSPAN8)-VLPs Recombinant Protein | TSPAN8-VLPs recombinant protein

Recombinant Human Tetraspanin-8 (TSPAN8)-VLPs (Active)

Cat. Num. AAA279398

• Gene Names: TSPAN8; CO-029; TM4SF3
• Purity: The purity information is not available for VLPs proteins.
• Synonyms: Tetraspanin-8 (TSPAN8)-VLPs; N/A; Recombinant Human Tetraspanin-8 (TSPAN8)-VLPs (Active); Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029; TSPAN8-VLPs recombinant protein

• Host: Mammalian cell
• Purity/Purification: The purity information is not available for VLPs proteins.
• Form/Format: Lyophilized powder. Lyophilized from a 0.2um sterile filtered PBS, 6% Trehalose, pH 7.4
• Sequence Positions: 1-237aa; Full Length
• Sequence: MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK

• Species: Homo sapiens (Human)
• Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
• Transmembrane Domain: 4TM
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80 degree C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5ug/mL can bind Anti-TSPAN8 recombinant antibody . The EC50 is 2.261-2.623ng/mL.The VLPs is negative control.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Notes: The VLPs are expressed from human 293 cells (HEK293). Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended. Store the protein at -20 degree C/-80 degree C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Application Data

(Detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.))

Bioactivity

Related Product Information for TSPAN8-VLPs recombinant protein

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling.

Product Categories/Family for TSPAN8-VLPs recombinant protein

Cancer

References

Silencing of long non-coding RNA SOX21-AS1 inhibits lung adenocarcinoma invasion and migration by impairing TSPAN8 via transcription factor GATA6.Xu Y., Wu H., Wu L., Xu L., Li J., Wang Q., Pu X.Int J Biol Macromol 164:1294-1303 (2020)

NCBI and Uniprot Product Information

• NCBI GI #: 4759238
• NCBI GeneID: 7103
• NCBI Accession #: NP_004607.1
• NCBI GenBank Nucleotide #: NM_004616.2
• UniProt Accession #: P19075; Q9BS78; B2R7T7
• Molecular Weight: 26,044 Da
• NCBI Official Full Name: tetraspanin-8
• NCBI Official Synonym Full Names: tetraspanin 8
• NCBI Official Symbol: TSPAN8
• NCBI Official Synonym Symbols: CO-029; TM4SF3
• NCBI Protein Information: tetraspanin-8; tspan-8; tumor-associated antigen CO-029; transmembrane 4 superfamily member 3
• UniProt Protein Name: Tetraspanin-8
• UniProt Gene Name: TSPAN8
• UniProt Synonym Gene Names: TM4SF3; Tspan-8
• UniProt Entry Name: TSN8_HUMAN