Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA279398_AD13.jpg Application Data (Detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.))

Tetraspanin-8 (TSPAN8)-VLPs Recombinant Protein | TSPAN8-VLPs recombinant protein

Recombinant Human Tetraspanin-8 (TSPAN8)-VLPs (Active)

Average rating 0.0
No ratings yet
Gene Names
TSPAN8; CO-029; TM4SF3
Purity
The purity information is not available for VLPs proteins.
Synonyms
Tetraspanin-8 (TSPAN8)-VLPs; N/A; Recombinant Human Tetraspanin-8 (TSPAN8)-VLPs (Active); Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029; TSPAN8-VLPs recombinant protein
Ordering
Host
Mammalian cell
Purity/Purification
The purity information is not available for VLPs proteins.
Form/Format
Lyophilized powder. Lyophilized from a 0.2um sterile filtered PBS, 6% Trehalose, pH 7.4
Sequence Positions
1-237aa; Full Length
Sequence
MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Transmembrane Domain
4TM
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80 degree C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5ug/mL can bind Anti-TSPAN8 recombinant antibody . The EC50 is 2.261-2.623ng/mL.The VLPs is negative control.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Notes: The VLPs are expressed from human 293 cells (HEK293). Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended. Store the protein at -20 degree C/-80 degree C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Application Data

(Detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.))

product-image-AAA279398_AD13.jpg Application Data (Detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.))

Bioactivity

product-image-AAA279398_BIOACTIVITY15.jpg Bioactivity
Related Product Information for TSPAN8-VLPs recombinant protein
Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling.
Product Categories/Family for TSPAN8-VLPs recombinant protein
References
Silencing of long non-coding RNA SOX21-AS1 inhibits lung adenocarcinoma invasion and migration by impairing TSPAN8 via transcription factor GATA6.Xu Y., Wu H., Wu L., Xu L., Li J., Wang Q., Pu X.Int J Biol Macromol 164:1294-1303 (2020)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,044 Da
NCBI Official Full Name
tetraspanin-8
NCBI Official Synonym Full Names
tetraspanin 8
NCBI Official Symbol
TSPAN8
NCBI Official Synonym Symbols
CO-029; TM4SF3
NCBI Protein Information
tetraspanin-8; tspan-8; tumor-associated antigen CO-029; transmembrane 4 superfamily member 3
UniProt Protein Name
Tetraspanin-8
UniProt Gene Name
TSPAN8
UniProt Synonym Gene Names
TM4SF3; Tspan-8
UniProt Entry Name
TSN8_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TSPAN8-VLPs tspan8 (Catalog #AAA279398) is a Recombinant Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-237aa; Full Length. The amino acid sequence is listed below: MAGVSACIKY SMFTFNFLFW LCGILILALA IWVRVSNDSQ AIFGSEDVGS SSYVAVDILI AVGAIIMILG FLGCCGAIKE SRCMLLLFFI GLLLILLLQV ATGILGAVFK SKSDRIVNET LYENTKLLSA TGESEKQFQE AIIVFQEEFK CCGLVNGAAD WGNNFQHYPE LCACLDKQRP CQSYNGKQVY KETCISFIKD FLAKNLIIVI GISFGLAVIE ILGLVFSMVL YCQIGNK. It is sometimes possible for the material contained within the vial of "Tetraspanin-8 (TSPAN8)-VLPs, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.