Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA230767_SDS_PAGE15.jpg SDS-PAGE

Translocator protein (TSPO) Recombinant Protein | TSPO recombinant protein

Recombinant Pig Translocator protein (TSPO)

Gene Names
TSPO; PBR; BZRP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Translocator protein (TSPO); N/A; Recombinant Pig Translocator protein (TSPO); TSPO recombinant protein
Ordering
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-169aa; Full Length
Sequence
MAPPWLPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLAPIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFFGARQMGWALVDLVLTGGVAAATAVAWYQVSPLAARLLYPYLAWLAFAATLNYCVWRDNQGRRGGRRPSE
Sequence Length
169
Species
Pig
Production Note
Special Offer: The Cell Free host-expressed protein is manufactured from a stock plasmid containing the protein gene. Cell Freehost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Cell Free host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Cell Free host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

product-image-AAA230767_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for TSPO recombinant protein
Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides
Product Categories/Family for TSPO recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.6 kDa
NCBI Official Full Name
translocator protein
NCBI Official Symbol
TSPO
NCBI Official Synonym Symbols
PBR; BZRP
NCBI Protein Information
translocator protein
UniProt Protein Name
Translocator protein
UniProt Gene Name
TSPO
UniProt Synonym Gene Names
BZRP; PBR
UniProt Entry Name
TSPO_PIG

Similar Products

Product Notes

The TSPO tspo (Catalog #AAA230767) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-169aa; Full Length. The amino acid sequence is listed below: MAPPWLPAVG FTLVPSLGGF LSSRNVLGKG LHWYAGLQKP SWHPPHWTLA PIWGTLYSAM GYGSYMIWKE LGGFSEEAVV PLGLYAGQLA LNWAWPPLFF GARQMGWALV DLVLTGGVAA ATAVAWYQVS PLAARLLYPY LAWLAFAATL NYCVWRDNQG RRGGRRPSE. It is sometimes possible for the material contained within the vial of "Translocator protein (TSPO), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.