Non-receptor tyrosine-protein kinase TYK2 (Tyk2) Recombinant Protein | Tyk2 recombinant protein
Recombinant Mouse Non-receptor tyrosine-protein kinase TYK2 (Tyk2) , partial
Gene Names
Tyk2; JTK1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Non-receptor tyrosine-protein kinase TYK2 (Tyk2); N/A; Recombinant Mouse Non-receptor tyrosine-protein kinase TYK2 (Tyk2) , partial; Tyk2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
884-1174aa; Partial
Sequence
SDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKEGCGPQLRSGWQREIEILRTLYHEHIVKYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHCVGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASDVWSFGVTLYELLTYCDSNQSPHMKFTELIGHTQGQMTVLRLTELLERGERLPRPDRCPCEIYHLMKNCWETEASFRPTFQNLVPILQTAQEKYQ
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Tyk2 recombinant protein
This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphorylating receptor subunits. It is also component of both the type I and type III interferon signaling pathways. As such, it may play a role in anti-viral immunity. A mutation in this gene has been associated with hyperimmunoglobulin E syndrome (HIES) - a primary immunodeficiency characterized by elevated serum immunoglobulin E.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
133,315 Da
NCBI Official Full Name
non-receptor tyrosine-protein kinase TYK2 isoform 2
NCBI Official Synonym Full Names
tyrosine kinase 2
NCBI Official Symbol
Tyk2
NCBI Official Synonym Symbols
JTK1
NCBI Protein Information
non-receptor tyrosine-protein kinase TYK2
UniProt Protein Name
Non-receptor tyrosine-protein kinase TYK2
UniProt Gene Name
Tyk2
Similar Products
Product Notes
The Tyk2 tyk2 (Catalog #AAA116823) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 884-1174aa; Partial. The amino acid sequence is listed below: SDPTVFHKRY LKKIRDLGEG HFGKVSLYCY DPTNDGTGEM VAVKALKEGC GPQLRSGWQR EIEILRTLYH EHIVKYKGCC EDQGEKSVQL VMEYVPLGSL RDYLPRHCVG LAQLLLFAQQ ICEGMAYLHA QHYIHRDLAA RNVLLDNDRL VKIGDFGLAK AVPEGHEYYR VREDGDSPVF WYAPECLKEC KFYYASDVWS FGVTLYELLT YCDSNQSPHM KFTELIGHTQ GQMTVLRLTE LLERGERLPR PDRCPCEIYH LMKNCWETEA SFRPTFQNLV PILQTAQEKY Q. It is sometimes possible for the material contained within the vial of "Non-receptor tyrosine-protein kinase TYK2 (Tyk2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.