Sequence
(The Herpesvirus 6B Glycoprotein Q1(U100) (Q9QJ11) sequence contains two 'X' (red arrows), X refers to any amino acid. The two 'X' are each replaced with 'S' for protein manufacture.)
herpesvirus 6B Glycoprotein 105 (U100) Recombinant Protein | U100 recombinant protein
Recombinant Human herpesvirus 6B Glycoprotein 105 (U100), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
herpesvirus 6B Glycoprotein 105 (U100); N/A; Recombinant Human herpesvirus 6B Glycoprotein 105 (U100), partial; U100 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-354aa; Partial
Sequence
TVHRDAGTVESTPPPDDEDNYTAKYYDDSIYFNIYDGTNPTPRRRTLPEIISKFSTSEMSRLGGLKAFVPVDYTPTTTLEDIEDLLNYAICDDNSCGCLIETEARSMFGDIIICVPLSAESRGVRNLKSRIMPMGLSQILSSGLGLHFSLLYGAFGSNYNSLAYMERLKPLTAMTAIAFCPMTSKLELRQNYRLEKARSNLIVNIELLKIQNHGGQTIKTLTSFAIVRKDSDGQDWETCTRFASVSIEDILRSKPAANGTCCPPRDVHHDRPTLQSSNSWTRTEYFEPWQDVVDAYVPINDNHCPNDSYVVFQTLQGHEWCSRLNKNDTK
Species
Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Sequence
(The Herpesvirus 6B Glycoprotein Q1(U100) (Q9QJ11) sequence contains two 'X' (red arrows), X refers to any amino acid. The two 'X' are each replaced with 'S' for protein manufacture.)
Sequence
(The Herpesvirus 6B Glycoprotein Q1(U100) (Q9QJ11) sequence contains two 'X' (red arrows), X refers to any amino acid. The two 'X' are each replaced with 'S' for protein manufacture.)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,045 Da
NCBI Official Full Name
spliced envelope glycoprotein
NCBI Official Symbol
U100
NCBI Protein Information
gp82-105 complex
UniProt Protein Name
Glycoprotein Q1
UniProt Gene Name
U100
UniProt Synonym Gene Names
gQ1; gp105; gQ-80k
Similar Products
Product Notes
The U100 u100 (Catalog #AAA117610) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-354aa; Partial. The amino acid sequence is listed below: TVHRDAGTVE STPPPDDEDN YTAKYYDDSI YFNIYDGTNP TPRRRTLPEI ISKFSTSEMS RLGGLKAFVP VDYTPTTTLE DIEDLLNYAI CDDNSCGCLI ETEARSMFGD IIICVPLSAE SRGVRNLKSR IMPMGLSQIL SSGLGLHFSL LYGAFGSNYN SLAYMERLKP LTAMTAIAFC PMTSKLELRQ NYRLEKARSN LIVNIELLKI QNHGGQTIKT LTSFAIVRKD SDGQDWETCT RFASVSIEDI LRSKPAANGT CCPPRDVHHD RPTLQSSNSW TRTEYFEPWQ DVVDAYVPIN DNHCPNDSYV VFQTLQGHEW CSRLNKNDTK. It is sometimes possible for the material contained within the vial of "herpesvirus 6B Glycoprotein 105 (U100), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.