Mitochondrial brown fat uncoupling protein 1 Recombinant Protein | UCP1 recombinant protein
Recombinant Human Mitochondrial brown fat uncoupling protein 1
Gene Names
UCP1; UCP; SLC25A7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial brown fat uncoupling protein 1; N/A; Recombinant Human Mitochondrial brown fat uncoupling protein 1; Solute carrier family 25 member 7; Thermogenin; UCP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-307aa; Full Length of Mature Protein
Sequence
GGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for UCP1 recombinant protein
UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.
Product Categories/Family for UCP1 recombinant protein
References
Human uncoupling protein gene structure, comparison with rat gene, and assignment to the long arm of chromosome 4.Cassard A.M., Bouillaud F., Mattei M.-G., Hentz E., Raimbault S., Thomas M., Ricquier D.J. Cell. Biochem. 43:255-264(1990) Bouillaud F.Sequence of the cDNA coding for the human uncoupling protein UCP.Bouillaud F., Ricquier D., Raimbault S. Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Detection of brown adipose tissue uncoupling protein mRNA in adult patients by a human genomic probe.Bouillaud F., Villarroya F., Hentz E., Raimbault S., Cassard A.M., Ricquier D.Clin. Sci. 75:21-27(1988) A polymorphism in the 5' untranslated region and a Met229-->Leu variant in exon 5 of the human UCP1 gene are associated with susceptibility to type II diabetes mellitus.Mori H., Okazawa H., Iwamoto K., Maeda E., Hashiramoto M., Kasuga M.Diabetologia 44:373-376(2001) Uncoupling protein 1 and 3 polymorphisms are associated with waist-to-hip ratio.Herrmann S.M., Wang J.G., Staessen J.A., Kertmen E., Schmidt-Petersen K., Zidek W., Paul M., Brand E.J. Mol. Med. 81:327-332(2003)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34.9 kDa
NCBI Official Full Name
mitochondrial brown fat uncoupling protein 1
NCBI Official Synonym Full Names
uncoupling protein 1 (mitochondrial, proton carrier)
NCBI Official Symbol
UCP1
NCBI Official Synonym Symbols
UCP; SLC25A7
NCBI Protein Information
mitochondrial brown fat uncoupling protein 1
UniProt Protein Name
Mitochondrial brown fat uncoupling protein 1
UniProt Gene Name
UCP1
UniProt Synonym Gene Names
SLC25A7; UCP; UCP 1
UniProt Entry Name
UCP1_HUMAN
Similar Products
Product Notes
The UCP1 ucp1 (Catalog #AAA113913) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-307aa; Full Length of Mature Protein. The amino acid sequence is listed below: GGLTASDVHP TLGVQLFSAG IAACLADVIT FPLDTAKVRL QVQGECPTSS VIRYKGVLGT ITAVVKTEGR MKLYSGLPAG LQRQISSASL RIGLYDTVQE FLTAGKETAP SLGSKILAGL TTGGVAVFIG QPTEVVKVRL QAQSHLHGIK PRYTGTYNAY RIIATTEGLT GLWKGTTPNL MRSVIINCTE LVTYDLMKEA FVKNNILADD VPCHLVSALI AGFCATAMSS PVDVVKTRFI NSPPGQYKSV PNCAMKVFTN EGPTAFFKGL VPSFLRLGSW NVIMFVCFEQ LKRELSKSRQ TMDCAT. It is sometimes possible for the material contained within the vial of "Mitochondrial brown fat uncoupling protein 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
