Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18774_SDS_PAGE.jpg SDS-PAGE

Uroplakin-3a (Upk3a) Recombinant Protein | Upk3a recombinant protein

Recombinant Mouse Uroplakin-3a (Upk3a), partial

Gene Names
Upk3a; UP3a; Upk3; UPIII; 1110017C07Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uroplakin-3a (Upk3a); N/A; Recombinant Mouse Uroplakin-3a (Upk3a), partial; Upk3a recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-207aa; Partial
Sequence
VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLSGSYEVYLYAMVDSAMSRNVSVQDSAGVPLSTTFRQTQGGRSGPYKAAAFDLTPCGDLPSLDAVGDVTQASEILNAYLVRVGNNGTCFWDPNFQGLCNPPLTAATEYRFKYVLVNMSTGLVQDQTLWSDPIWTNRPIPYSAIDTWPGRRSGG
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

product-image-AAA18774_SDS_PAGE.jpg SDS-PAGE
Related Product Information for Upk3a recombinant protein
Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence
Product Categories/Family for Upk3a recombinant protein
References
"Origin of the tetraspanin uroplakins and their co-evolution with associated proteins: implications for uroplakin structure and function." Garcia-Espana A., Chung P.-J., Zhao X., Lee A., Pellicer A., Yu J., Sun T.-T., Desalle R. Mol. Phylogenet. Evol. 41:355-367(2006)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25.5 kDa
NCBI Official Full Name
uroplakin-3a
NCBI Official Synonym Full Names
uroplakin 3A
NCBI Official Symbol
Upk3a
NCBI Official Synonym Symbols
UP3a; Upk3; UPIII; 1110017C07Rik
NCBI Protein Information
uroplakin-3a
UniProt Protein Name
Uroplakin-3a
UniProt Gene Name
Upk3a
UniProt Synonym Gene Names
Upk3; UP3a; UPIII

Similar Products

Product Notes

The Upk3a upk3a (Catalog #AAA18774) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-207aa; Partial. The amino acid sequence is listed below: VNLQPQLASV TFATNNPTLT TVALEKPLCM FDSSEPLSGS YEVYLYAMVD SAMSRNVSVQ DSAGVPLSTT FRQTQGGRSG PYKAAAFDLT PCGDLPSLDA VGDVTQASEI LNAYLVRVGN NGTCFWDPNF QGLCNPPLTA ATEYRFKYVL VNMSTGLVQD QTLWSDPIWT NRPIPYSAID TWPGRRSGG . It is sometimes possible for the material contained within the vial of "Uroplakin-3a (Upk3a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.