Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA29733_SDS_PAGE.jpg SDS-PAGE (Greather than 90% as determined by SDS-PAGE)

Vesicle-associated membrane protein 2 (VAMP2) Recombinant Protein | VAMP2 recombinant protein

Recombinant Human Vesicle-associated membrane protein 2 (VAMP2)

Average rating 0.0
No ratings yet
Gene Names
VAMP2; SYB2; VAMP-2
Reactivity
Human
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Vesicle-associated membrane protein 2 (VAMP2); N/A; Recombinant Human Vesicle-associated membrane protein 2 (VAMP2); Synaptobrevin-2; VAMP2 recombinant protein
Ordering
Host
E Coli
Reactivity
Human
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer, 50% glycerol
Sequence Positions
Full Length, 1-116aa
Sequence
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Calculated MW
39.7 kDa
Tag Info
N-terminal GST-tagged
Preparation and Storage
The shelf life is related to man factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.

Generally, the shelf life of liquid form is 6 months at -20°C to -80°C.

The shelf life of lyophilized form is 12 months at -20°C to -80°C.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

SDS-PAGE

(Greather than 90% as determined by SDS-PAGE)

product-image-AAA29733_SDS_PAGE.jpg SDS-PAGE (Greather than 90% as determined by SDS-PAGE)
Related Product Information for VAMP2 recombinant protein
Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
vesicle-associated membrane protein 2 isoform 1
NCBI Official Synonym Full Names
vesicle associated membrane protein 2
NCBI Official Symbol
VAMP2
NCBI Official Synonym Symbols
SYB2; VAMP-2
NCBI Protein Information
vesicle-associated membrane protein 2
UniProt Protein Name
Vesicle-associated membrane protein 2
UniProt Gene Name
VAMP2
UniProt Synonym Gene Names
SYB2; VAMP-2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The VAMP2 vamp2 (Catalog #AAA29733) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 1-116aa. The Recombinant Human Vesicle-associated membrane protein 2 (VAMP2) reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MSATAATAPP AAPAGEGGPP APPPNLTSNR RLQQTQAQVD EVVDIMRVNV DKVLERDQKL SELDDRADAL QAGASQFETS AAKLKRKYWW KNLKMMIILG VICAIILIII IVYFST. It is sometimes possible for the material contained within the vial of "Vesicle-associated membrane protein 2 (VAMP2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.