Vitamin D3 receptor (VDR) Recombinant Protein | VDR recombinant protein
Recombinant Chicken Vitamin D3 receptor (VDR)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vitamin D3 receptor (VDR); N/A; Recombinant Chicken Vitamin D3 receptor (VDR); VDR recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-451aa; Full Length
Sequence
MSELRGSWDEQQQSMAYLPDADMDTVAASTSLPDPAGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKAMFTCPFNGDCKITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKESLKPKLSEEQQKVIDTLLEAHHKTFDTTYSDFNKFRPPVRSKFSSRMATHSSSVVSQDFSSEDSNDVFGSDAFAAFPEPMEPQMFSNLDLSEESDESPSMNIELPHLPMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEVIMLRSNQSFTMEDMSWTCGSNDFKYKVSDVTQAGHSMDLLEPLVKFQVGLKKLNLHEEEHVLLMAICILSPDRPGVQDTSLVESIQDRLSDILQTYIRCRHPPPGSRLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPEHSMQLTPLVLEVFGNEIS
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for VDR recombinant protein
This gene encodes the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarity to the steroid and thyroid hormone receptors. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternative splicing results in multiple transcript variants encoding the same protein.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,213 Da
NCBI Official Full Name
vitamin D3 receptor
NCBI Official Synonym Full Names
vitamin D (1,25- dihydroxyvitamin D3) receptor
NCBI Official Symbol
VDR
NCBI Protein Information
vitamin D3 receptor
UniProt Protein Name
Vitamin D3 receptor
UniProt Gene Name
VDR
UniProt Synonym Gene Names
NR1I1; VDR
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The VDR vdr (Catalog #AAA115621) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-451aa; Full Length. The amino acid sequence is listed below: MSELRGSWDE QQQSMAYLPD ADMDTVAAST SLPDPAGDFD RNVPRICGVC GDRATGFHFN AMTCEGCKGF FRRSMKRKAM FTCPFNGDCK ITKDNRRHCQ ACRLKRCVDI GMMKEFILTD EEVQRKREMI LKRKEEEALK ESLKPKLSEE QQKVIDTLLE AHHKTFDTTY SDFNKFRPPV RSKFSSRMAT HSSSVVSQDF SSEDSNDVFG SDAFAAFPEP MEPQMFSNLD LSEESDESPS MNIELPHLPM LPHLADLVSY SIQKVIGFAK MIPGFRDLTA EDQIALLKSS AIEVIMLRSN QSFTMEDMSW TCGSNDFKYK VSDVTQAGHS MDLLEPLVKF QVGLKKLNLH EEEHVLLMAI CILSPDRPGV QDTSLVESIQ DRLSDILQTY IRCRHPPPGS RLLYAKMIQK LADLRSLNEE HSKQYRCLSF QPEHSMQLTP LVLEVFGNEI S. It is sometimes possible for the material contained within the vial of "Vitamin D3 receptor (VDR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.