Vascular endothelial growth factor A Recombinant Protein | VEGFA recombinant protein

Recombinant Human Vascular endothelial growth factor A

Cat. Num. AAA113912

• Gene Names: VEGFA; VPF; VEGF; MVCD1
• Purity: Greater than 90% as determined by SDS-PAGE.
• Synonyms: Vascular endothelial growth factor A; N/A; Recombinant Human Vascular endothelial growth factor A; Vascular permeability factor; VPF; VEGFA recombinant protein

• Purity/Purification: Greater than 90% as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 27-232
• Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Sequence Length: 412

• Product Note: Applications are user defined. Product is developed and quality control tested in house, data or additional information may be provided upon request. The researcher needs to establish and confirm the suitability of the product for their application.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for VEGFA recombinant protein

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.

Product Categories/Family for VEGFA recombinant protein

Cancer; Raw Materials Assay Development

References

Vascular endothelial growth factor is a secreted angiogenic mitogen.Leung D.W., Cachianes G., Kuang W.-J., Goeddel D.V., Ferrara N.Science 246:1306-1309(1989) Vascular permeability factor, an endothelial cell mitogen related to PDGF.Keck P.J., Hauser S.D., Krivi G., Sanzo K., Warren T., Feder J., Connolly D.T.Science 246:1309-1312(1989) The human gene for vascular endothelial growth factor. Multiple protein forms are encoded through alternative exon splicing.Tischer E., Mitchell R., Hartman T., Silva M., Gospodarowicz D., Fiddes J.C., Abraham J.A.J. Biol. Chem. 266:11947-11954(1991) The vascular endothelial growth factor family identification of a fourth molecular species and characterization of alternative splicing of RNA.Houck K.A., Ferrara N., Winer J., Cachianes G., Li B., Leung D.W.Mol. Endocrinol. 5:1806-1814(1991) AIDS-associated Kaposi's sarcoma cells in culture express vascular endothelial growth factor.Weindel K., Marme D., Weich H.A.Biochem. Biophys. Res. Commun. 183:1167-1174(1992) VEGF145, a secreted vascular endothelial growth factor isoform that binds to extracellular matrix.Poltorak Z., Cohen T., Sivan R., Kandelis Y., Spira G., Vlodavsky I., Keshet E., Neufeld G.J. Biol. Chem. 272:7151-7158(1997) Identification and characterization of a new splicing variant of vascular endothelial growth factor VEGF183.Lei J., Jiang A., Pei D.Biochim. Biophys. Acta 1443:400-406(1998) Identification of a human VPF/VEGF 3' untranslated region mediating hypoxia-induced mRNA stability.Claffey K.P., Shih S.-C., Mullen A., Dziennis S., Cusick J.L., Abrams K.R., Lee S.W., Detmar M.Mol. Biol. Cell 9:469-481(1998) Heterogeneous vascular endothelial growth factor (VEGF) isoform mRNA and receptor mRNA expression in human glomeruli, and the identification of VEGF148 mRNA, a novel truncated splice variant.Whittle C.J., Gillespie K.M., Harrison R., Mathieson P.W., Harper S.J.Clin. Sci. 97:303-312(1999) VEGF165b, an inhibitory splice variant of vascular endothelial growth factor, is down-regulated in renal cell carcinoma.Bates D.O., Cui T.-G., Doughty J.M., Winkler M., Sugiono M., Shields J.D., Peat D., Gillatt D., Harper S.J.Cancer Res. 62:4123-4131(2002) Human cDNA for the vascular endothelial growth factor isoform VEGF165.Murata H., Fukushima J., Hattori S., Okuda K., Yanagi H. Human cDNA for vascular endothelial growth factor isoform VEGF121.Sato J.D., Whitney R.G.Cloning of vascular endothelial growth factor (VEGF) cDNA.Liu J., Peng X., Yuan J., Qiang B.Cloning and identification of vascular endothelial growth factor isoform VEGF165.Shan Z.X., Yu X.Y., Lin Q.X., Fu Y.H., Zheng M., Tan H.H., Lin S.G. Cloning and characterization of VEGF from LNCaP cells, a line of prostate cancer cells.Koul S., Johnson T., Meacham R.B., Koul H.K.VEGF111, a new VEGF-A variant lacking exons 5, 6 and 7.Mineur P.J., Colige A.C., Lambert C.A.Human protein factory for converting the transcriptome into an in vitro-expressed proteome.Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B., Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.Nat. Methods 5:1011-1017(2008) The DNA sequence and analysis of human chromosome 6.Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.Nature 425:805-811(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 76781480
• NCBI GeneID: 7422
• NCBI Accession #: NP_001020537.2
• NCBI GenBank Nucleotide #: NM_001025366.2
• UniProt Accession #: P15692; O60720; O75875; Q074Z4; Q16889; B5BU86; H0Y2S8; H0Y407; H0Y414; H0Y462; H0Y8N2; H3BLW7
• Molecular Weight: 51.3kD
• NCBI Official Full Name: vascular endothelial growth factor A isoform a
• NCBI Official Synonym Full Names: vascular endothelial growth factor A
• NCBI Official Symbol: VEGFA
• NCBI Official Synonym Symbols: VPF; VEGF; MVCD1
• NCBI Protein Information: vascular endothelial growth factor A
• UniProt Protein Name: Vascular endothelial growth factor A
• UniProt Gene Name: VEGFA
• UniProt Synonym Gene Names: VEGF; VEGF-A; VPF
• UniProt Entry Name: VEGFA_HUMAN