Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114033_SDS_PAGE15.jpg SDS-PAGE

Vascular endothelial growth factor C Recombinant Protein | Vegfc recombinant protein

Recombinant Mouse Vascular endothelial growth factor C

Gene Names
Vegfc; VEGF-C; AW228853
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vascular endothelial growth factor C; N/A; Recombinant Mouse Vascular endothelial growth factor C; Flt4 ligand; Flt4-L; Vascular endothelial growth factor-related protein; VRP; Vegfc recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
108-223aa; Full Length
Sequence
AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Sequence Length
223
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114033_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Vegfc recombinant protein
Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.
References
VEGF-C receptor binding and pattern of expression with VEGFR-3 suggests a role in lymphatic vascular development.Kukk E., Lymboussaki A., Taira S., Kaipainen A., Jeltsch M., Joukov V., Alitalo K.Development 122:3829-3837(1996) Characterization of murine Flt4 ligand/VEGF-C.Fitz L.J., Morris J.C., Towler P., Long A., Burgess P., Greco R., Wang J., Gassaway R., Nickbarg E., Kovacic S., Ciarletta A., Giannotti J., Finnerty H., Zollner R., Beier D.R., Leak L.V., Turner K.J., Wood C.R.Oncogene 15:613-618(1997) Characterization of novel VEGF (vascular endothelial growth factor) -C splicing isoforms from mouse.Wang Z.G., Puri T.S., Quigg R.J.Biochem. J. 428:347-354(2010) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15 kDa
NCBI Official Full Name
vascular endothelial growth factor C
NCBI Official Synonym Full Names
vascular endothelial growth factor C
NCBI Official Symbol
Vegfc
NCBI Official Synonym Symbols
VEGF-C; AW228853
NCBI Protein Information
vascular endothelial growth factor C
UniProt Protein Name
Vascular endothelial growth factor C
UniProt Gene Name
Vegfc
UniProt Synonym Gene Names
VEGF-C; Flt4-L; VRP
UniProt Entry Name
VEGFC_MOUSE

Similar Products

Product Notes

The Vegfc vegfc (Catalog #AAA114033) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 108-223aa; Full Length. The amino acid sequence is listed below: AHYNTEILKS IDNEWRKTQC MPREVCIDVG KEFGAATNTF FKPPCVSVYR CGGCCNSEGL QCMNTSTGYL SKTLFEITVP LSQGPKPVTI SFANHTSCRC MSKLDVYRQV HSIIRR. It is sometimes possible for the material contained within the vial of "Vascular endothelial growth factor C, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.