VlsE protein of Borrelia burgdorferi Recombinant Protein | VlsE recombinant protein
Recombinant VlsE protein of Borrelia burgdorferi
Applications
Western Blot, ELISA
Purity
>= 95% (by SDS-PAGE)
Synonyms
VlsE protein of Borrelia burgdorferi; N/A; Recombinant VlsE protein of Borrelia burgdorferi; VlsE Protein of Borrelia burgdorferi; VlsE recombinant protein
Host
HEK293 cells
Purity/Purification
>= 95% (by SDS-PAGE)
Concentration
1 ug/ul in PBS (20% glycerol, 0.1% sodium azide) (varies by lot)
Sequence
HHHHHHGSSQVADKDDPTNKFYQSVIQLGNGFLDVFTSFGGLVAEAFGFKSDPKKSDVKTYFTTVAAKLEKTKTDLNSLPKEKSDISSTTGKPDSTGSVGTAVEGAIKEVSELLDKLVKAVKTAEGASGTAAIGEVVADADAAKVADKASVKGIAKGIKEIVEAAGGSEKLKAVAAAKGENNKGAGKLFGKAGAAAHGDSEAASKAAGAVSAVSGEQILSAIVTAADAAEQDGKKPEEAKNPIAAAIGDKDGGAFGQDEMKKDDQIAAAIALRGMAKDGKFAVKDGEKEKAEGAIKGAAESAVRKVLGAITGLIGDAVSSGLRKVGDSVKAASKETPPALNK
Applicable Applications for VlsE recombinant protein
WB (Western Blot), Antigen, ELISA
Viral Protein
6x His tagged VIsE protein (Genebank No. U76405)
Preparation and Storage
Store at -20°C; Stable for 1-months from the date of shipment when kept at 4°C . Non-hazardous. No MSDS required
Related Product Information for VlsE recombinant protein
Recombinant protein purified from 293 cell culture
Introduction: VlsE is an outer surface lipoprotein of Borrelia burgdorferi that undergoes antigenic variation through an elaborate gene conversion mechanism and is thought to play a major role in the immune response to the Lyme disease borreliosis.
Introduction: VlsE is an outer surface lipoprotein of Borrelia burgdorferi that undergoes antigenic variation through an elaborate gene conversion mechanism and is thought to play a major role in the immune response to the Lyme disease borreliosis.
Product Categories/Family for VlsE recombinant protein
References
1. Zhang, J.R., et al. Antigenic variation in Lyme disease borreliae by promiscuous recombination of VMP-like sequence cassettes. Cell 89: 275-285, 1997.
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The VlsE (Catalog #AAA13692) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's VlsE protein of Borrelia burgdorferi can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), Antigen, ELISA. Researchers should empirically determine the suitability of the VlsE for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HHHHHHGSSQ VADKDDPTNK FYQSVIQLGN GFLDVFTSFG GLVAEAFGFK SDPKKSDVKT YFTTVAAKLE KTKTDLNSLP KEKSDISSTT GKPDSTGSVG TAVEGAIKEV SELLDKLVKA VKTAEGASGT AAIGEVVADA DAAKVADKAS VKGIAKGIKE IVEAAGGSEK LKAVAAAKGE NNKGAGKLFG KAGAAAHGDS EAASKAAGAV SAVSGEQILS AIVTAADAAE QDGKKPEEAK NPIAAAIGDK DGGAFGQDEM KKDDQIAAAI ALRGMAKDGK FAVKDGEKEK AEGAIKGAAE SAVRKVLGAI TGLIGDAVSS GLRKVGDSVK AASKETPPAL NK. It is sometimes possible for the material contained within the vial of "VlsE protein of Borrelia burgdorferi, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
