VSNL1 recombinant protein
Recombinant Human VSNL1 Protein
Gene Names
VSNL1; HLP3; VILIP; HPCAL3; HUVISL1; VILIP-1
Applications
SDS-Page, ELISA, Western Blot
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
VSNL1; N/A; Recombinant Human VSNL1 Protein; HLP3; VISL1; HPCAL3; HUVISL1; VILIP; VILIP-1; VLP-1; Hippocalcin Like Protein 3.; VSNL1 recombinant protein
Host
E Coli
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
PBS, pH 7.4, with 50% glycerol.
Concentration
1.8 mg/mL (varies by lot)
Sequence Positions
1-191
Sequence
MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Applicable Applications for VSNL1 recombinant protein
SDS-PAGE, ELISA, WB (Western Blot)
Source
Human
Tag
N-terminal GST-tag
Usage
VSNL1 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Storage: Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
**Avoid repeated freeze-thaw cycles.**
Stability: The recombinant protein is stable for up to 6 months from date of receipt at -80°C.
**Avoid repeated freeze-thaw cycles.**
Stability: The recombinant protein is stable for up to 6 months from date of receipt at -80°C.
Related Product Information for VSNL1 recombinant protein
VSNL1 is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. The (CA)n microsatellite repeat embedded in the 3-prime untranslated region of the gene was conserved between rat and human, along with the flanking DNA sequences. By genetic linkage studies in 11 CEPH families, they mapped the VSNL1 gene to 2p.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Predicted MW: 49 kDa
Observed MW: 44 kDa
Observed MW: 44 kDa
NCBI Official Full Name
visinin-like protein 1
NCBI Official Synonym Full Names
visinin like 1
NCBI Official Symbol
VSNL1
NCBI Official Synonym Symbols
HLP3; VILIP; HPCAL3; HUVISL1; VILIP-1
NCBI Protein Information
visinin-like protein 1
UniProt Protein Name
Visinin-like protein 1
UniProt Gene Name
VSNL1
UniProt Synonym Gene Names
VISL1; VILIP; VLP-1; HLP3
UniProt Entry Name
VISL1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The VSNL1 vsnl1 (Catalog #AAA55962) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-191. AAA Biotech's VSNL1 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the VSNL1 vsnl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGKQNSKLAP EVMEDLVKST EFNEHELKQW YKGFLKDCPS GRLNLEEFQQ LYVKFFPYGD ASKFAQHAFR TFDKNGDGTI DFREFICALS ITSRGSFEQK LNWAFNMYDL DGDGKITRVE MLEIIEAIYK MVGTVIMMKM NEDGLTPEQR VDKIFSKMDK NKDDQITLDE FKEAAKSDPS IVLLLQCDIQ K. It is sometimes possible for the material contained within the vial of "VSNL1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.