Wiskott-Aldrich syndrome protein family member 2 (Wasf2) Recombinant Protein | Wasf2 recombinant protein
Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)
Gene Names
Wasf2; WAVE2; AW742646; D4Ertd13e
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Wiskott-Aldrich syndrome protein family member 2 (Wasf2); N/A; Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2); Wasf2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-497, full length protein
Sequence
MPLVTRNIEPRHLCRQTLPSDTSELECRTNITLANVIRQLGSLSKYAEDIFGEICTQASAFASRVNSLAERVDRVQVKVTQLDPKEEEVSLQGINTRKAFRSSTTQDQKLFDRNSLPVPVLETYNSCDAPPPLNNLSPYRDDGKEALKFYTNPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKERLGPSGYSSTLVYQNGSIGSVENVDAASYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPADNQRGSVLAGPKRTSMVSPSHPPPAPPLSSPPGPKPGFAPPPAPPPPPPMSVPPPLPSMGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPMPPPPLSQPSGGAPPPPPPPPPPGPPPLPFSGADGQPAAPPPPPPSEATKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD
Sequence Length
497
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Wasf2 recombinant protein
This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,074 Da
NCBI Official Full Name
wiskott-Aldrich syndrome protein family member 2
NCBI Official Synonym Full Names
WAS protein family, member 2
NCBI Official Symbol
Wasf2
NCBI Official Synonym Symbols
WAVE2; AW742646; D4Ertd13e
NCBI Protein Information
wiskott-Aldrich syndrome protein family member 2
UniProt Protein Name
Wiskott-Aldrich syndrome protein family member 2
UniProt Gene Name
Wasf2
UniProt Synonym Gene Names
WASP family protein member 2
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Wasf2 wasf2 (Catalog #AAA116953) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-497, full length protein. The amino acid sequence is listed below: MPLVTRNIEP RHLCRQTLPS DTSELECRTN ITLANVIRQL GSLSKYAEDI FGEICTQASA FASRVNSLAE RVDRVQVKVT QLDPKEEEVS LQGINTRKAF RSSTTQDQKL FDRNSLPVPV LETYNSCDAP PPLNNLSPYR DDGKEALKFY TNPSYFFDLW KEKMLQDTKD IMKEKRKHRK EKKDNPNRGN VNPRKIKTRK EEWEKMKMGQ EFVESKERLG PSGYSSTLVY QNGSIGSVEN VDAASYPPPP QSDSASSPSP SFSEDNLPPP PAEFSYPADN QRGSVLAGPK RTSMVSPSHP PPAPPLSSPP GPKPGFAPPP APPPPPPMSV PPPLPSMGFG SPGTPPPPSP PSFPPHPDFA APPPPPPPPA ADYPMPPPPL SQPSGGAPPP PPPPPPPGPP PLPFSGADGQ PAAPPPPPPS EATKPKSSLP AVSDARSDLL SAIRQGFQLR RVEEQREQEK RDVVGNDVAT ILSRRIAVEY SDSEDDSSEF DEDDWSD. It is sometimes possible for the material contained within the vial of "Wiskott-Aldrich syndrome protein family member 2 (Wasf2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
