West Nile Pre-M Virus Recombinant Protein | WNV recombinant protein
Recombinant West Nile Pre-M Virus
Applications
Western Blot, ELISA
Purity
Protein is >95% pure as determined by SDS-PAGE.Purified by proprietary chromatographic technique.
Synonyms
West Nile Pre-M Virus; N/A; Recombinant West Nile Pre-M Virus; WNV Pre-M; West Nile Virus Pre-M Recombinant; WNV recombinant protein
Specificity
Immunoreactive with sera of West Nile virus infected individuals.
Purity/Purification
Protein is >95% pure as determined by SDS-PAGE.
Purified by proprietary chromatographic technique.
Purified by proprietary chromatographic technique.
Form/Format
20mM phosphate buffer pH 7.5.
Sequence
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Applicable Applications for WNV recombinant protein
WB (Western Blot), ELISA
Preparation and Storage
WNV Pre-M although stable at 4 degree C for 1 week, should be stored below -18 degree C. Please prevent freeze thaw cycles.
Related Product Information for WNV recombinant protein
Description: The E Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag.
Introduction: West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.
Introduction: West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.
Product Categories/Family for WNV recombinant protein
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The WNV (Catalog #AAA38545) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's West Nile Pre-M Virus can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the WNV for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVTLSNFQGK VMMTVNATDV TDVITIPTAA GKNLCIVRA MDVGYLCEDT ITYECPVLAA GNDPEDIDCW CTKSSVYVRY GRCTKTRHSR RSRRSLTVQT HGESTLANKK GAWLDSTKAT RYLVKTESWI LRNPGYALE. It is sometimes possible for the material contained within the vial of "West Nile Pre-M Virus, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.