Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA117539_SDS_PAGE15.jpg SDS-PAGE

WNT1-inducible-signaling pathway protein 2 Recombinant Protein | Wisp2 recombinant protein

Recombinant Mouse WNT1-inducible-signaling pathway protein 2 (Wisp2)

Average rating 0.0
No ratings yet
Gene Names
Wisp2; Ccn5; Crgr4; Ctgfl; Rcop1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
WNT1-inducible-signaling pathway protein 2; N/A; Recombinant Mouse WNT1-inducible-signaling pathway protein 2 (Wisp2); CCN family member 5; Connective tissue growth factor-like protein; CTGF-L; Wisp2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-251aa; Full Length of Mature Protein
Sequence
QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA117539_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Wisp2 recombinant protein
May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
References
WISP genes are members of the connective tissue growth factor family that are up-regulated in wnt-1-transformed cells and aberrantly expressed in human colon tumors.Pennica D., Swanson T.A., Welsh J.W., Roy M.A., Lawrence D.A., Lee J., Brush J., Taneyhill L.A., Deuel B., Lew M., Watanabe C., Cohen R.L., Melham M.F., Finley G.G., Quirke P., Goddard A.D., Hillan K.J., Gurney A.L., Botstein D., Levine A.J.Proc. Natl. Acad. Sci. U.S.A. 95:14717-14722(1998) Identification and cloning of a connective tissue growth factor-like cDNA from human osteoblasts encoding a novel regulator of osteoblast functions.Kumar S., Hand A.T., Connor J.R., Dodds R.A., Ryan P.J., Trill J.J., Fisher S.M., Nuttall M.E., Lipshutz D.B., Zou C., Hwang S.M., Votta B.J., James I.E., Rieman D.J., Gowen M., Lee J.C.J. Biol. Chem. 274:17123-17131(1999)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.5 kDa
NCBI Official Full Name
WNT1-inducible-signaling pathway protein 2
NCBI Official Synonym Full Names
WNT1 inducible signaling pathway protein 2
NCBI Official Symbol
Wisp2
NCBI Official Synonym Symbols
Ccn5; Crgr4; Ctgfl; Rcop1
NCBI Protein Information
WNT1-inducible-signaling pathway protein 2
UniProt Protein Name
WNT1-inducible-signaling pathway protein 2
UniProt Gene Name
Wisp2
UniProt Synonym Gene Names
Ccn5; Ctgfl; WISP-2; CTGF-L
UniProt Entry Name
WISP2_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Wisp2 wisp2 (Catalog #AAA117539) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-251aa; Full Length of Mature Protein. The amino acid sequence is listed below: QLCPAPCACP WTPPQCPPGV PLVLDGCGCC RVCARRLGES CDHLHVCDPS QGLVCQPGAG PSGRGAVCLF EEDDGSCEVN GRRYLDGETF KPNCRVLCRC DDGGFTCLPL CSEDVRLPSW DCPRPRRIQV PGRCCPEWVC DQAVMQPAIQ PSSAQGHQLS ALVTPASADG PCPNWSTAWG PCSTTCGLGI ATRVSNQNRF CQLEIQRRLC LSRPCLASRS HGSWNSAF. It is sometimes possible for the material contained within the vial of "WNT1-inducible-signaling pathway protein 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.