Lymphocyte antigen 6 complex locus protein G6d (LY6G6D) Active Protein | LY6G6D active protein
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D)
Gene Names
LY6G6D; G6D; NG25; LY6-D; MEGT1; C6orf23
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lymphocyte antigen 6 complex locus protein G6d (LY6G6D); N/A; Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D); LY6G6D active protein
Host
Yeast
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-104aa; Full Length of Mature Protein
Sequence
NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
References
"Transcriptional analysis of a novel cluster of LY-6 family members in the human and mouse major histocompatibility complex: five genes with many splice forms." Mallya M., Campbell R.D., Aguado B. Genomics 80:113-123(2002)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
11.1 kDa
NCBI Official Full Name
lymphocyte antigen 6 complex locus protein G6d
NCBI Official Synonym Full Names
lymphocyte antigen 6 family member G6D
NCBI Official Symbol
LY6G6D
NCBI Official Synonym Symbols
G6D; NG25; LY6-D; MEGT1; C6orf23
NCBI Protein Information
lymphocyte antigen 6 complex locus protein G6d
UniProt Protein Name
Lymphocyte antigen 6 complex locus protein G6d
UniProt Gene Name
LY6G6D
UniProt Synonym Gene Names
C6orf23; G6D; MEGT1; NG25; Protein Ly6-D
Similar Products
Product Notes
The LY6G6D ly6g6d (Catalog #AAA18703) is an Active Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-104aa; Full Length of Mature Protein. The amino acid sequence is listed below: NRMRCYNCGG SPSSSCKEAV TTCGEGRPQP GLEQIKLPGN PPVTLIHQHP ACVAAHHCNQ VETESVGDVT YPAHRDCYLG DLCNS. It is sometimes possible for the material contained within the vial of "Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.