SDS-PAGE
Pertactin autotransporter (prn) Recombinant Protein | prn recombinant protein
Recombinant Bordetella pertussis Pertactin autotransporter (prn), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pertactin autotransporter (prn); Recombinant Bordetella pertussis Pertactin autotransporter (prn); partial; P.93; prn recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
632-910aa; Partial
Sequence
ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for prn recombinant protein
Agglutinogen that binds to eukaryotic cells; a process mediated by the R-G-D sequence. Pertactin may have a role in bacterial adhesion, and thus play a role in virulence. May contribute to the disease state of whooping cough.
References
Molecular cloning and characterization of protective outer membrane protein P.69 from Bordetella pertussis.Charles I.G., Dougan G., Pickard D., Chatfield S., Smith M., Novotny P., Morrissey P., Fairweather N.F.Proc. Natl. Acad. Sci. U.S.A. 86:3554-3558(1989)
Cloning, nucleotide sequence and heterologous expression of the protective outer-membrane protein P.68 pertactin from Bordetella bronchiseptica.Li J.L., Fairweather N.F., Novotny P., Dougan G., Charles I.G.J. Gen. Microbiol. 138:1697-1705(1992)
Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica.Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N.R., Harris D.E., Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L., Cerdeno-Tarraga A.-M., Temple L., James K.D., Harris B., Quail M.A., Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I., Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T., Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S., Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E., Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M., Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S., Barrell B.G., Maskell D.J.Nat. Genet. 35:32-40(2003)
Crystallization and preliminary X-ray diffraction analysis of P30, the transmembrane domain of pertactin, an autotransporter from Bordetella pertussis.Zhu Y., Black I., Roszak A.W., Isaacs N.W.Acta Crystallogr. F 63:593-595(2007)
Structure of Bordetella pertussis virulence factor P.69 pertactin.Emsley P., Charles I.G., Fairweather N.F., Isaacs N.W.Nature 381:90-92(1996)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45.8 kDa
NCBI Official Full Name
pertactin autotransporter
NCBI Official Symbol
prn
NCBI Protein Information
pertactin autotransporter
UniProt Protein Name
Pertactin autotransporter
UniProt Gene Name
prn
UniProt Synonym Gene Names
omp69A
UniProt Entry Name
PERT_BORPE
Similar Products
Product Notes
The prn prn (Catalog #AAA18585) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 632-910aa; Partial. The amino acid sequence is listed below: ALSKRLGELR LNPDAGGAWG RGFAQRQQLD NRAGRRFDQK VAGFELGADH AVAVAGGRWH LGGLAGYTRG DRGFTGDGGG HTDSVHVGGY ATYIADSGFY LDATLRASRL ENDFKVAGSD GYAVKGKYRT HGVGASLEAG RRFTHADGWF LEPQAELAVF RAGGGAYRAA NGLRVRDEGG SSVLGRLGLE VGKRIELAGG RQVQPYIKAS VLQEFDGAGT VHTNGIAHRT ELRGTRAELG LGMAAALGRG HSLYASYEYS KGPKLAMPWT FHAGYRYSW . It is sometimes possible for the material contained within the vial of "Pertactin autotransporter (prn), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
