Transmembrane protease serine 2 (TMPRSS2) Active Protein | TMPRSS2 active protein

Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial

Cat. Num. AAA18665

• Gene Names: TMPRSS2; PP9284; PRSS10
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transmembrane protease serine 2 (TMPRSS2); N/A; Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial; TMPRSS2 active protein

• Host: Yeast
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 106-492aa; Partial.
• Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for TMPRSS2 active protein

This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 227499990
• NCBI GeneID: 7113
• NCBI Accession #: NP_001128571.1
• NCBI GenBank Nucleotide #: NM_001135099.1
• UniProt Accession #: O15393; Q6GTK7; Q9BXX1; A8K6Z8; B2R8E5; B7Z459; D3DSJ2; F8WES1
• Molecular Weight: 44.8 kDa
• NCBI Official Full Name: transmembrane protease serine 2 isoform 1
• NCBI Official Synonym Full Names: transmembrane serine protease 2
• NCBI Official Symbol: TMPRSS2
• NCBI Official Synonym Symbols: PP9284; PRSS10
• NCBI Protein Information: transmembrane protease serine 2
• UniProt Protein Name: Transmembrane protease serine 2
• UniProt Gene Name: TMPRSS2
• UniProt Synonym Gene Names: PRSS10