Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-SLC25A4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: RPMI 8226 cell lysateSLC25A4 is supported by BioGPS gene expression data to be expressed in RPMI 8226)

Rabbit SLC25A4 Polyclonal Antibody | anti-SLC25A4 antibody

SLC25A4 antibody - N-terminal region

Gene Names
SLC25A4; T1; ANT; AAC1; ANT1; PEO2; PEO3; ANT 1; PEOA2; MTDPS12; MTDPS12A
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SLC25A4; Polyclonal Antibody; SLC25A4 antibody - N-terminal region; anti-SLC25A4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
Sequence Length
298
Applicable Applications for anti-SLC25A4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SLC25A4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: RPMI 8226 cell lysateSLC25A4 is supported by BioGPS gene expression data to be expressed in RPMI 8226)

WB (Western Blot) (WB Suggested Anti-SLC25A4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: RPMI 8226 cell lysateSLC25A4 is supported by BioGPS gene expression data to be expressed in RPMI 8226)

WB (Western Blot)

(Host: RatTarget Name: SLC25A4Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: RatTarget Name: SLC25A4Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SLC25A4Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: SLC25A4Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SLC25A4Sample Tissue: Human RPMI-8226Antibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: SLC25A4Sample Tissue: Human RPMI-8226Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SLC25A4Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: SLC25A4Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SLC25A4Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: SLC25A4Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-SLC25A4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic in cell bodies of pinealocytes and their processesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry) (Rabbit Anti-SLC25A4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic in cell bodies of pinealocytes and their processesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-SLC25A4 antibody
This is a rabbit polyclonal antibody against SLC25A4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
291
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
ADP/ATP translocase 1
NCBI Official Synonym Full Names
solute carrier family 25 member 4
NCBI Official Symbol
SLC25A4
NCBI Official Synonym Symbols
T1; ANT; AAC1; ANT1; PEO2; PEO3; ANT 1; PEOA2; MTDPS12; MTDPS12A
NCBI Protein Information
ADP/ATP translocase 1
UniProt Protein Name
ADP/ATP translocase 1
UniProt Gene Name
Slc25a4
UniProt Synonym Gene Names
Ant1; ANT 1
UniProt Entry Name
ADT1_RAT

Similar Products

Product Notes

The SLC25A4 slc25a4 (Catalog #AAA23510) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC25A4 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SLC25A4 slc25a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLQVQHASKQ ISAEKQYKGI IDCVVRIPKE QGFLSFWRGN LANVIRYFPT. It is sometimes possible for the material contained within the vial of "SLC25A4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.