Mouse Cystinosin Monoclonal Antibody | anti-CTNS antibody

Cystinosin (CTNS) APC

Cat. Num. AAA24479

• Gene Names: CTNS; PQLC4; SLC66A4; CTNS-LSB
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Cystinosin, Antibody; Cystinosin (CTNS) APC; anti-CTNS antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5G6
• Specificity: Recognizes human Cystinosin. Species Crossreactivity: mouse, rat
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 367

• Applicable Applications for anti-CTNS antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa1-100 of human Cystinosin with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVY
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of CTNS expression in PC-12 using)

WB (Western Blot)

(Western Blot detection against immunogen using (36.74kD).)

WB (Western Blot)

(Western Blot analysis of CTNS expression in Raw 264.7)

WB (Western Blot)

(Western Blot analysis of CTNS expression in HepG2)

WB (Western Blot)

(Western Blot analysis of CTNS expression in human liver)

Application Data

(Detection limit is ~0.3ng/ml using as a capture antibody.)

Related Product Information for anti-CTNS antibody

This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants.

Product Categories/Family for anti-CTNS antibody

Antibodies; Transport Proteins

References

1. Modulation of CTNS Gene Expression By Intracellular Thiols. Bellomo F, Corallini S, Pastore A, Palma A, Laurenzi C, Emma F, Taranta A.Free Radic Biol Med. 2010 Jan 14.

NCBI and Uniprot Product Information

• NCBI GI #: 119943110
• NCBI GeneID: 1497
• NCBI Accession #: NP_004928
• NCBI GenBank Nucleotide #: NM_004937
• UniProt Accession #: O60931
• NCBI Official Full Name: cystinosin isoform 2
• NCBI Official Synonym Full Names: cystinosin, lysosomal cystine transporter
• NCBI Official Symbol: CTNS
• NCBI Official Synonym Symbols: PQLC4; SLC66A4; CTNS-LSB
• NCBI Protein Information: cystinosin
• UniProt Protein Name: Cystinosin
• UniProt Gene Name: CTNS
• UniProt Entry Name: CTNS_HUMAN