Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SNAI2 on HepG2 cell. [antibody concentration 10ug/ml].)

Mouse SNAI2 Monoclonal Antibody | anti-SNAI2 antibody

SNAI2 (Zinc Finger Protein SNAI2, Neural Crest Transcription Factor Slug, Protein Snail Homolog 2, SLUG, SLUGH, MGC10182) (HRP)

Gene Names
SNAI2; SLUG; WS2D; SLUGH; SLUGH1; SNAIL2
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SNAI2; Monoclonal Antibody; SNAI2 (Zinc Finger Protein SNAI2; Neural Crest Transcription Factor Slug; Protein Snail Homolog 2; SLUG; SLUGH; MGC10182) (HRP); anti-SNAI2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
3C12
Specificity
Recognizes human SNAI2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SNAI2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa97-170 from human SNAI2 (NP_003059) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV*
Conjugate
HRP
Preparation and Storage
May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SNAI2 on HepG2 cell. [antibody concentration 10ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SNAI2 on HepG2 cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(SNAI2 monoclonal antibody (M05). Western Blot analysis of SNAI2 expression in NIH/3T3.)

WB (Western Blot) (SNAI2 monoclonal antibody (M05). Western Blot analysis of SNAI2 expression in NIH/3T3.)

WB (Western Blot)

(SNAI2 monoclonal antibody (M05). Western Blot analysis of SNAI2 expression in Raw 264.7.)

WB (Western Blot) (SNAI2 monoclonal antibody (M05). Western Blot analysis of SNAI2 expression in Raw 264.7.)

WB (Western Blot)

(SNAI2 monoclonal antibody (M05), Western Blot analysis of SNAI2 expression in HepG2.)

WB (Western Blot) (SNAI2 monoclonal antibody (M05), Western Blot analysis of SNAI2 expression in HepG2.)

WB (Western Blot)

(SNAI2 monoclonal antibody. Western Blot analysis of SNAI2 expression in PC-12.)

WB (Western Blot) (SNAI2 monoclonal antibody. Western Blot analysis of SNAI2 expression in PC-12.)

WB (Western Blot)

(SNAI2 monoclonal antibody. Western Blot analysis of SNAI2 expression in human liver.)

WB (Western Blot) (SNAI2 monoclonal antibody. Western Blot analysis of SNAI2 expression in human liver.)

WB (Western Blot)

(Western Blot detection against Immunogen (34.14kD).)

WB (Western Blot) (Western Blot detection against Immunogen (34.14kD).)
Related Product Information for anti-SNAI2 antibody
This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity.The tumor suppressor protein p53 induces Slug expression in g-irradiated cells; Slug protects damaged cells from apoptosis by repressing p53-induced transcription of the proapoptotic Bcl-2 family protein Puma. Mutations in this gene may be associated with sporatic cases of neural tube defects.
Product Categories/Family for anti-SNAI2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.4kDa (291aa)
NCBI Official Full Name
zinc finger protein SNAI2
NCBI Official Synonym Full Names
snail family transcriptional repressor 2
NCBI Official Symbol
SNAI2
NCBI Official Synonym Symbols
SLUG; WS2D; SLUGH; SLUGH1; SNAIL2
NCBI Protein Information
zinc finger protein SNAI2
UniProt Protein Name
Zinc finger protein SNAI2
UniProt Gene Name
SNAI2
UniProt Synonym Gene Names
SLUG; SLUGH
UniProt Entry Name
SNAI2_HUMAN

Similar Products

Product Notes

The SNAI2 snai2 (Catalog #AAA25550) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SNAI2 (Zinc Finger Protein SNAI2, Neural Crest Transcription Factor Slug, Protein Snail Homolog 2, SLUG, SLUGH, MGC10182) (HRP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SNAI2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNAI2 snai2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNAI2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.