Mouse anti-Human SOX9 Monoclonal Antibody | anti-SOX9 antibody

SOX9 (Transcription Factor SOX-9, SOX 9) (HRP)

Cat. Num. AAA25554

• Gene Names: SOX9; CMD1; SRA1; CMPD1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SOX9, Antibody; SOX9 (Transcription Factor SOX-9, SOX 9) (HRP); anti-SOX9 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3C10
• Specificity: Recognizes human SOX9.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SOX9 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 0.7ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa400-510 from human SOX9 (NP_000337) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

IP (Immunoprecipitation)

(Immunoprecipitation of SOX9 transfected lysate using SOX9 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SOX9 rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SOX9 on HepG2 cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.7ug/ml].)

WB (Western Blot)

(Western Blot analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody. Lane 1: SOX9 transfected lysate (56.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(SOX9 monoclonal antibody, Western Blot analysis of SOX9 expression in HepG2.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.21kD).)

Product Categories/Family for anti-SOX9 antibody

Antibodies; Transcription Factors

References

1. A Molecular Profile of Focal Segmental Glomerulosclerosis from Formalin-Fixed, Paraffin-Embedded Tissue. Hodgin JB, Borczuk AC, Nasr SH, Markowitz GS, Nair V, Martini S, Eichinger F, Vining C, Berthier CC, Kretzler M, D'Agati VD.Am J Pathol. 2010 Oct;177(4):1674-86. Epub 2010 Sep 16.

NCBI and Uniprot Product Information

• NCBI GI #: 4557853
• NCBI GeneID: 6662
• NCBI Accession #: NP_000337
• NCBI GenBank Nucleotide #: NM_000346
• UniProt Accession #: P48436; Q53Y80
• Molecular Weight: 56,137 Da
• NCBI Official Full Name: transcription factor SOX-9
• NCBI Official Synonym Full Names: SRY (sex determining region Y)-box 9
• NCBI Official Symbol: SOX9
• NCBI Official Synonym Symbols: CMD1; SRA1; CMPD1
• NCBI Protein Information: transcription factor SOX-9; SRY (sex-determining region Y)-box 9 protein; SRY-related HMG-box, gene 9
• UniProt Protein Name: Transcription factor SOX-9
• UniProt Gene Name: SOX9
• UniProt Entry Name: SOX9_HUMAN