Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Mouse BANF1 Monoclonal Antibody | anti-BANF1 antibody

BANF1 (Barrier to Autointegration Factor 1, BAF, BCRP1, D14S1460, MGC111161) (AP)

Gene Names
BANF1; BAF; NGPS; BCRP1; D14S1460
Applications
Western Blot
Purity
Purified
Synonyms
BANF1, Antibody; BANF1 (Barrier to Autointegration Factor 1, BAF, BCRP1, D14S1460, MGC111161) (AP); Barrier to Autointegration Factor 1; BAF; BCRP1; D14S1460; MGC111161; anti-BANF1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
M2
Specificity
Recognizes BANF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-BANF1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
BANF1 (AAH05942, 1aa-89aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(BANF1 monoclonal antibody (M07), clone M2. Western Blot analysis of BANF1 expression in PC-12.)

WB (Western Blot)

(BANF1 monoclonal antibody (M07), clone M2. Western Blot analysis of BANF1 expression in Raw 264.7.)

WB (Western Blot)

(BANF1 monoclonal antibody (M07), clone M2. Western Blot analysis of BANF1 expression in Jurkat.)

Application Data

(Detection limit for recombinant GST tagged BANF1 is approximately 10ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to BANF1 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to BANF1 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-BANF1 antibody
The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein.
Product Categories/Family for anti-BANF1 antibody
References
1. Functional Disruption of the Moloney Murine Leukemia Virus Preintegration Complex by Vaccinia-related Kinases. Suzuki Y, Ogawa K, Koyanagi Y, Suzuki Y.J Biol Chem. 2010 Jul 30;285(31):24032-43. Epub 2010 May 28.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
10,059 Da
NCBI Official Full Name
Barrier to autointegration factor 1
NCBI Official Synonym Full Names
barrier to autointegration factor 1
NCBI Official Symbol
BANF1
NCBI Official Synonym Symbols
BAF; NGPS; BCRP1; D14S1460
NCBI Protein Information
barrier-to-autointegration factor; breakpoint cluster region protein 1
UniProt Protein Name
Barrier-to-autointegration factor
UniProt Gene Name
BANF1
UniProt Synonym Gene Names
BAF; BCRG1
UniProt Entry Name
BAF_HUMAN

Similar Products

Product Notes

The BANF1 banf1 (Catalog #AAA25911) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BANF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BANF1 banf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BANF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.