Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

Application Data (Detection limit for recombinant GST tagged PGR is approximately 0.1ng/ml as a capture antibody.)

Mouse PGR Monoclonal Antibody | anti-PGR antibody

PGR (Progesterone Receptor, NR3C3, PR) (AP)

Gene Names
PGR; PR; NR3C3
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
PGR; Monoclonal Antibody; PGR (Progesterone Receptor; NR3C3; PR) (AP); Progesterone Receptor; PR; anti-PGR antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C2
Specificity
Recognizes PGR.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PGR antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PGR (NP_000917, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged PGR is approximately 0.1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged PGR is approximately 0.1ng/ml as a capture antibody.)

WB (Western Blot)

(PGR monoclonal antibody (M04), clone 2C2 Western Blot analysis of PGR expression in A-431.)

WB (Western Blot) (PGR monoclonal antibody (M04), clone 2C2 Western Blot analysis of PGR expression in A-431.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PGR on A-431 cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to PGR on A-431 cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PGR on A-431 cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to PGR on A-431 cell. [antibody concentration 10 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1.5 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1.5 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1.5 ug/ml])

Application Data (Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1.5 ug/ml])
Related Product Information for anti-PGR antibody
Mouse monoclonal antibody raised against a partial recombinant PGR. This PGR gene uses two distinct promoters and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform B. Our immunogen corresponds to the specific region of isoform B, thus this antibody is a PGR isofrom B specific antibody.
Product Categories/Family for anti-PGR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,747 Da
NCBI Official Full Name
progesterone receptor isoform B
NCBI Official Synonym Full Names
progesterone receptor
NCBI Official Symbol
PGR
NCBI Official Synonym Symbols
PR; NR3C3
NCBI Protein Information
progesterone receptor; nuclear receptor subfamily 3 group C member 3
UniProt Protein Name
Progesterone receptor
UniProt Gene Name
PGR
UniProt Synonym Gene Names
NR3C3; PR
UniProt Entry Name
PRGR_HUMAN

Similar Products

Product Notes

The PGR pgr (Catalog #AAA25925) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PGR can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PGR pgr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PGR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.