Mouse STAT5B Monoclonal Antibody | anti-STAT5B antibody

STAT5B (Signal Transducer and Activator of Transcription 5B, STAT5) (HRP)

Cat. Num. AAA26470

• Gene Names: STAT5B; STAT5
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: STAT5B, Antibody; STAT5B (Signal Transducer and Activator of Transcription 5B, STAT5) (HRP); Signal Transducer and Activator of Transcription 5B; STAT5; anti-STAT5B antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2D1
• Specificity: Recognizes STAT5B.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-STAT5B antibody: Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: STAT5B (NP_036580, 678aa-787aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged STAT5B is approximately 0.3ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to STAT5B on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1.5 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to STAT5B on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1.5 ug/ml])

WB (Western Blot)

(STAT5B monoclonal antibody (M03), clone 2D1 Western Blot analysis of STAT5B expression in HeLa (Cat # L013V1).)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-STAT5B antibody

Antibodies; Transcription Factors; STAT

NCBI and Uniprot Product Information

• NCBI GI #: 21618344
• NCBI GeneID: 6777
• NCBI Accession #: NP_036580
• NCBI GenBank Nucleotide #: NM_012448
• UniProt Accession #: P51692
• Molecular Weight: 90kDa
• NCBI Official Full Name: signal transducer and activator of transcription 5B
• NCBI Official Synonym Full Names: signal transducer and activator of transcription 5B
• NCBI Official Symbol: STAT5B
• NCBI Official Synonym Symbols: STAT5
• NCBI Protein Information: signal transducer and activator of transcription 5B
• UniProt Protein Name: Signal transducer and activator of transcription 5B
• UniProt Gene Name: STAT5B
• UniProt Entry Name: STA5B_HUMAN