Mouse PDK2 Monoclonal Antibody | anti-PDK2 antibody

PDK2 (Pyruvate Dehydrogenase Kinase, Isozyme 2, PDHK2) (PE)

Cat. Num. AAA26595

• Gene Names: PDK2; PDHK2; PDKII
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: PDK2, Antibody; PDK2 (Pyruvate Dehydrogenase Kinase, Isozyme 2, PDHK2) (PE); Pyruvate Dehydrogenase Kinase; Isozyme 2; PDHK2; anti-PDK2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5F8
• Specificity: Recognizes PDK2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 407

• Applicable Applications for anti-PDK2 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PDK2 (AAH05811, 187aa-276aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

IHC (Immunohistchemistry)

(Immunoperoxidase of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 2 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 2 ug/ml])

Application Data

(Detection limit for recombinant GST tagged PDK2 is approximately 0.03ng/ml as a capture antibody.)

WB (Western Blot)

(PDK2 monoclonal antibody (M02), clone 5F8. Western Blot analysis of PDK2 expression in A-431 (Cat # L015V1).)

WB (Western Blot)

(PDK2 monoclonal antibody (M02), clone 5F8. Western Blot analysis of PDK2 expression in 293 (Cat # L026V1).)

WB (Western Blot)

(PDK2 monoclonal antibody (M02), clone 5F8 Western Blot analysis of PDK2 expression in HeLa (Cat # L013V1).)

Related Product Information for anti-PDK2 antibody

Mouse monoclonal antibody raised against a partial recombinant PDK2.

Product Categories/Family for anti-PDK2 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 13543295
• NCBI GeneID: 5164
• NCBI Official Full Name: Pyruvate dehydrogenase kinase, isozyme 2
• NCBI Official Synonym Full Names: pyruvate dehydrogenase kinase 2
• NCBI Official Symbol: PDK2
• NCBI Official Synonym Symbols: PDHK2; PDKII
• NCBI Protein Information: pyruvate dehydrogenase kinase, isozyme 2