Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (PBK monoclonal antibody (M07), clone 3A7. Western Blot analysis of PBK expression in 293 (Cat # L026V1).)

Mouse PBK Monoclonal Antibody | anti-PBK antibody

PBK (PDZ Binding Kinase, FLJ14385, Nori-3, SPK, TOPK) (PE)

Gene Names
PBK; SPK; CT84; TOPK; HEL164; Nori-3
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
PBK; Monoclonal Antibody; PBK (PDZ Binding Kinase; FLJ14385; Nori-3; SPK; TOPK) (PE); PDZ Binding Kinase; TOPK; anti-PBK antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3A7
Specificity
Recognizes PBK.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
322
Applicable Applications for anti-PBK antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PBK (AAH15191, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(PBK monoclonal antibody (M07), clone 3A7. Western Blot analysis of PBK expression in 293 (Cat # L026V1).)

WB (Western Blot) (PBK monoclonal antibody (M07), clone 3A7. Western Blot analysis of PBK expression in 293 (Cat # L026V1).)

WB (Western Blot)

(PBK monoclonal antibody (M07), clone 3A7 Western Blot analysis of PBK expression in Hela S3 NE (Cat # L013V3).)

WB (Western Blot) (PBK monoclonal antibody (M07), clone 3A7 Western Blot analysis of PBK expression in Hela S3 NE (Cat # L013V3).)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to PBK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to PBK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to PBK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])

Application Data (Immunoperoxidase of monoclonal antibody to PBK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])
Related Product Information for anti-PBK antibody
This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. [provided by RefSeq]
Product Categories/Family for anti-PBK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
PDZ binding kinase
NCBI Official Synonym Full Names
PDZ binding kinase
NCBI Official Symbol
PBK
NCBI Official Synonym Symbols
SPK; CT84; TOPK; HEL164; Nori-3
NCBI Protein Information
lymphokine-activated killer T-cell-originated protein kinase

Similar Products

Product Notes

The PBK (Catalog #AAA26611) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PBK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PBK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PBK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.