Mouse PRKDC Monoclonal Antibody | anti-PRKDC antibody

PRKDC (Protein Kinase, DNA-Activated, Catalytic Polypeptide, DNA-PKcs, DNAPK, DNPK1, HYRC, HYRC1, XRCC7, p350) (PE)

Cat. Num. AAA26620

• Gene Names: PRKDC; HYRC; p350; DNAPK; DNPK1; HYRC1; IMD26; XRCC7; DNAPKc; DNA-PKC; DNA-PKcs
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: PRKDC; Monoclonal Antibody; PRKDC (Protein Kinase; DNA-Activated; Catalytic Polypeptide; DNA-PKcs; DNAPK; DNPK1; HYRC; HYRC1; XRCC7; p350) (PE); Protein Kinase; p350; anti-PRKDC antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2A8
• Specificity: Recognizes PRKDC.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 4128

• Applicable Applications for anti-PRKDC antibody: Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PRKDC (NP_008835, 4019aa-4128aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGREPWM
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PRKDC on HeLa cell. [antibody concentration 40 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PRKDC on HeLa cell. [antibody concentration 40 ug/ml])

Application Data

(Detection limit for recombinant GST tagged PRKDC is 1 ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to PRKDC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to PRKDC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

WB (Western Blot)

(PRKDC monoclonal antibody (M03), clone 2A8 Western Blot analysis of PRKDC expression in Hela S3 NE (Cat # L013V3).)

Related Product Information for anti-PRKDC antibody

The PRKDC gene encodes the catalytic subunit of a nuclear DNA-dependent serine/threonine protein kinase (DNA-PK). The second component is the autoimmune antigen Ku (MIM 152690), which is encoded by the G22P1 gene on chromosome 22q. On its own, the catalytic subunit of DNA-PK is inactive and relies on the G22P1 component to direct it to the DNA and trigger its kinase activity; PRKDC must be bound to DNA to express its catalytic properties. [supplied by OMIM]

Product Categories/Family for anti-PRKDC antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 13654237
• NCBI GeneID: 5591
• NCBI Accession #: NP_008835
• NCBI GenBank Nucleotide #: NP_008835.5
• UniProt Accession #: P78527
• NCBI Official Full Name: DNA-dependent protein kinase catalytic subunit isoform 1
• NCBI Official Synonym Full Names: protein kinase, DNA-activated, catalytic subunit
• NCBI Official Symbol: PRKDC
• NCBI Official Synonym Symbols: HYRC; p350; DNAPK; DNPK1; HYRC1; IMD26; XRCC7; DNAPKc; DNA-PKC; DNA-PKcs
• NCBI Protein Information: DNA-dependent protein kinase catalytic subunit
• UniProt Protein Name: DNA-dependent protein kinase catalytic subunit
• UniProt Gene Name: PRKDC
• UniProt Synonym Gene Names: HYRC; HYRC1; DNA-PK catalytic subunit; DNA-PKcs
• UniProt Entry Name: PRKDC_HUMAN