Rabbit anti-Human PABPN1 Monoclonal Antibody | anti-PABPN1 antibody

PABPN1 Rabbit mAb

Cat. Num. AAA28464

• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
• Purity: Affinity purification
• Synonyms: PABPN1, Antibody; PABPN1 Rabbit mAb; OPMD; PAB2; PABII; PABP2; PABP-2; PABPN1; anti-PABPN1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE

• Applicable Applications for anti-PABPN1 antibody: Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA)
• Application Notes: WB: 1:1000-1:6000; IHC-P: 1:200-1:2000; IF/ICC: 1:200-1:2000; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PABPN1 (Q86U42).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using PABPN1 Rabbit mAb (AAA28464) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using PABPN1 Rabbit mAb (AAA28464) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using PABPN1 Rabbit mAb (AAA28464) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using PABPN1 Rabbit mAb (AAA28464) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using PABPN1 Rabbit mAb (AAA28464) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using PABPN1 Rabbit mAb (AAA28464) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using PABPN1 Rabbit mAb (AAA28464) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using PABPN1 Rabbit mAb (AAA28464) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using PABPN1 Rabbit mAb (AAA28464) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue tissue using PABPN1 Rabbit mAb (AAA28464) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using PABPN1 Rabbit mAb (AAA28464) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using PABPN1 Rabbit mAb (AAA28464) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using PABPN1 Rabbit mAb (AAA28464) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Related Product Information for anti-PABPN1 antibody

This gene encodes an abundant nuclear protein that binds with high affinity to nascent poly(A) tails. The protein is required for progressive and efficient polymerization of poly(A) tails at the 3' ends of eukaryotic transcripts and controls the size of the poly(A) tail to about 250 nt. At steady-state, this protein is localized in the nucleus whereas a different poly(A) binding protein is localized in the cytoplasm. This gene contains a GCG trinucleotide repeat at the 5' end of the coding region, and expansion of this repeat from the normal 6 copies to 8-13 copies leads to autosomal dominant oculopharyngeal muscular dystrophy (OPMD) disease. Related pseudogenes have been identified on chromosomes 19 and X. Read-through transcription also exists between this gene and the neighboring upstream BCL2-like 2 (BCL2L2) gene.

Product Categories/Family for anti-PABPN1 antibody

Epigenetics Nuclear Signaling; RNA Binding; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 4758876
• NCBI GeneID: 8106
• NCBI Accession #: NP_004634.1
• NCBI GenBank Nucleotide #: NM_004643.3
• UniProt Accession #: Q86U42; O43484; D3DS49
• Molecular Weight: Calculated MW: 31kDa/33kDa; Observed MW: 50kDa
• UniProt Protein Name: Polyadenylate-binding protein 2
• UniProt Gene Name: PABPN1
• UniProt Synonym Gene Names: PAB2; PABP2; PABP-2; Poly(A)-binding protein 2; PABII