Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts from HepG2 cells, using RXR? antibody (AAA28486) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

Rabbit anti-Human RXRalpha Monoclonal Antibody | anti-RXRA antibody

RXRalpha Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA, Chromatin Immunoprecipitation, Immunoprecipitation, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity purification
Synonyms
RXRalpha; Monoclonal Antibody; RXRalpha Rabbit mAb; NR2B1; RXR-alpha; anti-RXRA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNP
Applicable Applications for anti-RXRA antibody
Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA), Chromatin Immunoprecipitation (ChIP), Chromatin Immunoprecipitation (ChIP)-seq
Application Notes
WB: 1:1000-1:2000
IF/ICC: 1:100-1:1000
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
ChIP: 5ug antibody for 10ug-15ug of Chromatin
ChIP-seq: 1:50-1:100
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RXRalpha (P19793).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation analysis of extracts from HepG2 cells, using RXR? antibody (AAA28486) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts from HepG2 cells, using RXR? antibody (AAA28486) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts from HepG2 cells using 3 ug RXR? antibody (AAA28486). Western blot was performed from the immunoprecipitate using RXR? antibody (AAA28486) at a dilution of 1:1000.)

IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts from HepG2 cells using 3 ug RXR? antibody (AAA28486). Western blot was performed from the immunoprecipitate using RXR? antibody (AAA28486) at a dilution of 1:1000.)

ICC (Immunocytochemistry)

(Confocal imaging of HeLa cells using RXR? Rabbit mAb (AAA28486,dilution 1:100)(Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012,dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.)

ICC (Immunocytochemistry) (Confocal imaging of HeLa cells using RXR? Rabbit mAb (AAA28486,dilution 1:100)(Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012,dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.)

WB (Western Blot)

(Western blot analysis of various lysates using RXR? Rabbit mAb (AAA28486) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

WB (Western Blot) (Western blot analysis of various lysates using RXR? Rabbit mAb (AAA28486) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of various lysates using RXR? Rabbit mAb (AAA28486) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

WB (Western Blot) (Western blot analysis of various lysates using RXR? Rabbit mAb (AAA28486) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR? Rabbit mAb (AAA28486). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of RXR? in the representative genomic region surrounding ECH1 gene.)

ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR? Rabbit mAb (AAA28486). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of RXR? in the representative genomic region surrounding ECH1 gene.)

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR? Rabbit mAb (AAA28486). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of RXR? across chromosome 19 (upper panel) and the genomic region encompassing ECH1, a representative gene enriched in RXR? (lower panel).)

ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR? Rabbit mAb (AAA28486). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of RXR? across chromosome 19 (upper panel) and the genomic region encompassing ECH1, a representative gene enriched in RXR? (lower panel).)
Related Product Information for anti-RXRA antibody
Retinoid X receptors (RXRs) and retinoic acid receptors (RARs) are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors function as transcription factors by binding as homodimers or heterodimers to specific sequences in the promoters of target genes. The protein encoded by this gene is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. Alternative splicing of this gene results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 51kDa
Observed MW: 60kDa
UniProt Protein Name
Retinoic acid receptor RXR-alpha
UniProt Gene Name
RXRA
UniProt Synonym Gene Names
NR2B1
UniProt Entry Name
RXRA_HUMAN

Similar Products

Product Notes

The RXRA rxra (Catalog #AAA28486) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RXRalpha Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RXRalpha can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA), Chromatin Immunoprecipitation (ChIP), Chromatin Immunoprecipitation (ChIP)-seq. WB: 1:1000-1:2000 IF/ICC: 1:100-1:1000 IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. ChIP: 5ug antibody for 10ug-15ug of Chromatin ChIP-seq: 1:50-1:100. Researchers should empirically determine the suitability of the RXRA rxra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDTKHFLPLD FSTQVNSSLT SPTGRGSMAA PSLHPSLGPG IGSPGQLHSP ISTLSSPING MGPPFSVISS PMGPHSMSVP TTPTLGFSTG SPQLSSPMNP. It is sometimes possible for the material contained within the vial of "RXRalpha, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.