Rabbit anti-Human Bax Monoclonal Antibody | anti-BAX antibody

[KO Validated] Bax Rabbit mAb

Cat. Num. AAA28539

• Reactivity: Human
• Applications: Western Blot, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
• Purity: Affinity purification
• Synonyms: Bax, Antibody; [KO Validated] Bax Rabbit mAb; BCL2L4; ax; anti-BAX antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: GGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL

• Applicable Applications for anti-BAX antibody: Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA)
• Application Notes: WB: 1:2000-1:10000; IF/ICC: 1:100-1:2000; IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 10-70 of human Bax (NP_620116.1).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug Bax antibody (AAA28539). Western blot was performed from the immunoprecipitate using Bax antibody (AAA28539) at a dilution of 1:500.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using Bax Rabbit mAb (AAA28539) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH-3T3 cells using Bax Rabbit mAb (AAA28539) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using Bax Rabbit mAb (AAA28539) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of lysates from wild type(WT) and Bax knockout (KO) 293T cells, using [KO Validated] Bax Rabbit mAb (AAA28539) at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of various lysates, using [KO Validated] Bax Rabbit mAb (AAA28539) at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Related Product Information for anti-BAX antibody

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

Product Categories/Family for anti-BAX antibody

Cancer; Invasion and Metastasis; Signal Transduction; PI3K-Akt Signaling Pathway; MAPK-JNK Signaling Pathway; Cell Biology Developmental Biology; Apoptosis; Mitochondrial Control of Apoptosis; Inhibition of Apoptosis; Endocrine Metabolism; Mitochondrial m

NCBI and Uniprot Product Information

• NCBI GI #: 4757838
• NCBI GeneID: 581
• NCBI Accession #: NP_004315.1
• NCBI GenBank Nucleotide #: NM_004324.3
• UniProt Accession #: Q07812; P55269; Q07814; Q07815; Q8WZ49; Q9NR76; Q9NYG7; Q9UCZ6; Q9UCZ7; Q9UQD6; A8K4W1
• Molecular Weight: Calculated MW: 21kDa; Observed MW: 21kDa
• UniProt Protein Name: Apoptosis regulator BAX
• UniProt Gene Name: BAX
• UniProt Synonym Gene Names: BCL2L4; Bcl2-L-4
• UniProt Entry Name: BAX_HUMAN