Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IHC (Immunohistochemistry)
>
<
IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver tissue using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

Rabbit anti-Human HSP90B1 Monoclonal Antibody | anti-HSP90B1 antibody

[KD Validated] HSP90B1 Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, ELISA
Purity
Affinity purification
Synonyms
HSP90B1; Monoclonal Antibody; [KD Validated] HSP90B1 Rabbit mAb; ECGP; GP96; TRA1; GRP94; HEL35; HEL-S-125m; anti-HSP90B1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
EPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAV
Applicable Applications for anti-HSP90B1 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA)
Application Notes
WB: 1:1000-1:5000
IHC-P: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 616-715 of human HSP90B1 (NP_003290.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver tissue using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver tissue using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at 1:2000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

WB (Western Blot) (Western blot analysis of various lysates using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at 1:2000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and HSP90B1 knockdown (KD) HeLa cells using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at 1:2000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 20s.)

WB (Western Blot) (Western blot analysis of lysates from wild type (WT) and HSP90B1 knockdown (KD) HeLa cells using [KD Validated] HSP90B1 Rabbit mAb (AAA28575) at 1:2000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 20s.)
Related Product Information for anti-HSP90B1 antibody
This gene encodes a member of a family of adenosine triphosphate(ATP)-metabolizing molecular chaperones with roles in stabilizing and folding other proteins. The encoded protein is localized to melanosomes and the endoplasmic reticulum. Expression of this protein is associated with a variety of pathogenic states, including tumor formation. There is a microRNA gene located within the 5' exon of this gene. There are pseudogenes for this gene on chromosomes 1 and 15.
Product Categories/Family for anti-HSP90B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 92kDa
Observed MW: 100kDa
UniProt Protein Name
Endoplasmin
UniProt Gene Name
HSP90B1
UniProt Synonym Gene Names
GRP94; TRA1; GRP-94
UniProt Entry Name
ENPL_HUMAN

Similar Products

HSP90B1 Antibody

Host: Rabbit
Reactivity: Human
Apps: Western Blot, Immunohistochemistry, ELISA

MAPK ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a

MLK4 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

P P38MAPK ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

mitogen-activated protein kinase-activated protein kinase 2 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

AMPK ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a

AMPK ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a

APC ELISA Kit

Host: n/a
Reactivity: Rabbit
Apps: n/a

APC ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

AMPK ELISA Kit

Host: n/a
Reactivity: Chicken
Apps: n/a

P-JNK/SAPK ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

PKCdelta1 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

PKCi Antibody

Host: Rabbit
Reactivity: Human
Apps: Western Blot, Immunocytochemistry, Immunohistochemistry, ELISA

PTK ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

PLK1 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

CaM kinase ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

PRKCE ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

DAPK1 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

YES1 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

PTK7 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

Product Notes

The HSP90B1 hsp90b1 (Catalog #AAA28575) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] HSP90B1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSP90B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA). WB: 1:1000-1:5000 IHC-P: 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the HSP90B1 hsp90b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EPLLNWMKDK ALKDKIEKAV VSQRLTESPC ALVASQYGWS GNMERIMKAQ AYQTGKDIST NYYASQKKTF EINPRHPLIR DMLRRIKEDE DDKTVLDLAV. It is sometimes possible for the material contained within the vial of "HSP90B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

aaabiotech.com © 2012-2025

All rights reserved.

Contact us by

Tel: +1 (619) 604-9440 | Fax: +1 (619) 604-9440
[email protected]

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.