Multidrug resistance protein 1 Recombinant Protein | mrp1 recombinant protein

Recombinant Human Multidrug resistance protein 1

Cat. Num. AAA116200

• Gene Names: ABCB1; CLCS; MDR1; P-GP; PGY1; ABC20; CD243; GP170
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Multidrug resistance protein 1; N/A; Recombinant Human Multidrug resistance protein 1; ATP-binding cassette sub-family B member 1; P-glycoprotein 1; CD243; mrp1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 236-297aa; Partial
• Sequence: LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI
• Sequence Length: 1280

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for mrp1 recombinant protein

Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Product Categories/Family for mrp1 recombinant protein

Transport

References

Internal duplication and homology with bacterial transport proteins in the mdr1 (P-glycoprotein) gene from multidrug-resistant human cells.Chen C.-J., Chin J.E., Ueda K., Clark D.P., Pastan I., Gottesman M.M., Roninson I.B.Cell 47:381-389(1986) Genomic organization of the human multidrug resistance (MDR1) gene and origin of P-glycoproteins.Chen C.-J., Clark D.P., Ueda K., Pastan I., Gottesman M.M., Roninson I.B.J. Biol. Chem. 265:506-514(1990) Multidrug-resistant human sarcoma cells with a mutant P-glycoprotein, altered phenotype, and resistance to cyclosporins.Chen G., Duran G.E., Steger K.A., Lacayo N.J., Jaffrezou J.P., Dumontet C., Sikic B.I.J. Biol. Chem. 272:5974-5982(1997) Cloning of P-glycoprotein cDNA sequence from breast cancer MCF7 cell line.Jiang Y., Sun Q., Xie Z., Liu F., Xu W., Wang Y.NIEHS SNPs programComplete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence of human chromosome 7.Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.Nature 424:157-164(2003) mdr1/P-glycoprotein gene segments analyzed from various human leukemic cell lines exhibiting different multidrug resistance profiles.Gekeler V., Weger S., Probst H.Biochem. Biophys. Res. Commun. 169:796-802(1990) P-glycoprotein gene (MDR1) cDNA from human adrenal normal P-glycoprotein carries Gly185 with an altered pattern of multidrug resistance.Kioka N., Tsubota J., Kakehi Y., Komano T., Gottesman M.M., Pastan I., Ueda K.Biochem. Biophys. Res. Commun. 162:224-231(1989) ABC drug transporters hereditary polymorphisms and pharmacological impact in MDR1, MRP1 and MRP2.Kerb R., Hoffmeyer S., Brinkmann U.Pharmacogenomics 2:51-64(2001) Cytoplasmic domains of the transporter associated with antigen processing and P-glycoprotein interact with subunits of the proteasome.Begley G.S., Horvath A.R., Taylor J.C., Higgins C.F.Mol. Immunol. 42:137-141(2005) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Protein phosphatase complex PP5/PPP2R3C dephosphorylates P-glycoprotein/ABCB1 and down-regulates the expression and function.Katayama K., Yamaguchi M., Noguchi K., Sugimoto Y.Cancer Lett. 345:124-131(2014) An altered pattern of cross-resistance in multidrug-resistant human cells results from spontaneous mutations in the mdr1 (P-glycoprotein) gene.Choi K.H., Chen C.-J., Kriegler M., Roninson I.B.Cell 53:519-529(1988) Genetic polymorphism in MDR-1 a tool for examining allelic expression in normal cells, unselected and drug-selected cell lines, and human tumors.Mickley L.A., Lee J.-S., Weng Z., Zhan Z., Alvarez M., Wilson W., Bates S.E., Fojo T.Blood 91:1749-1756(1998) A new polymorphism (N21D) in the exon 2 of the human MDR1 gene encoding the P-glycoprotein.Decleves X., Chevillard S., Charpentier C., Vielh P., Laplanche J.-L.3.3.CO;2-G>Hum. Mutat. 15:486-486(2000) Functional polymorphisms of the human multidrug-resistance gene multiple sequence variations and correlation of one allele with P-glycoprotein expression and activity in vivo.Hoffmeyer S., Burk O., von Richter O., Arnold H.P., Brockmoeller J., Johne A., Cascorbi I., Gerloff T., Roots I., Eichelbaum M., Brinkmann U.Proc. Natl. Acad. Sci. U.S.A. 97:3473-3478(2000) Frequency of single nucleotide polymorphisms in the P-glycoprotein drug transporter MDR1 gene in white subjects.Cascorbi I., Gerloff T., Johne A., Meisel C., Hoffmeyer S., Schwab M., Schaeffeler E., Eichelbaum M., Brinkmann U., Roots I.Clin. Pharmacol. Ther. 69:169-174(2001) Polymorphism of MDR1 gene in healthy Japanese subjects a novel SNP with an amino acid substitution (Glu108Lys) .Honda T., Dan Y., Koyabu N., Ieiri I., Otsubo K., Higuchi S., Ohtani H., Sawada J.Drug Metab. Pharmacokinet. 17:479-481(2002) Twelve novel single nucleotide polymorphisms in ABCB1/MDR1 among Japanese patients with ventricular tachycardia who were administered amiodarone.Itoda M., Saito Y., Komamura K., Ueno K., Kamakura S., Ozawa S., Sawada J.Drug Metab. Pharmacokinet. 17:566-571(2002) Three hundred twenty-six genetic variations in genes encoding nine members of ATP-binding cassette, subfamily B (ABCB/MDR/TAP) , in the Japanese population.Saito S., Iida A., Sekine A., Miura Y., Ogawa C., Kawauchi S., Higuchi S., Nakamura Y.J. Hum. Genet. 47:38-50(2002) MDR1 Ala893 polymorphism is associated with inflammatory bowel disease.Brant S.R., Panhuysen C.I.M., Nicolae D., Reddy D.M., Bonen D.K., Karaliukas R., Zhang L., Swanson E., Datta L.W., Moran T., Ravenhill G., Duerr R.H., Achkar J.-P., Karban A.S., Cho J.H.Am. J. Hum. Genet. 73:1282-1292(2003) ErratumBrant S.R., Panhuysen C.I.M., Nicolae D., Reddy D.M., Bonen D.K., Karaliukas R., Zhang L., Swanson E., Datta L.W., Moran T., Ravenhill G., Duerr R.H., Achkar J.-P., Karban A.S., Cho J.H.Am. J. Hum. Genet. 74:1080-1080(2004) The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006) +Additional computationally mapped references.<p>Provides general information on the entry.

NCBI and Uniprot Product Information

• NCBI GI #: 42741659
• NCBI GeneID: 5243
• NCBI Accession #: NP_000918.2
• NCBI GenBank Nucleotide #: NM_000927.4
• UniProt Accession #: P08183; Q12755; Q14812; A8K294; B5AK60
• Molecular Weight: 10.8 kDa
• NCBI Official Full Name: multidrug resistance protein 1
• NCBI Official Synonym Full Names: ATP binding cassette subfamily B member 1
• NCBI Official Symbol: ABCB1
• NCBI Official Synonym Symbols: CLCS; MDR1; P-GP; PGY1; ABC20; CD243; GP170
• NCBI Protein Information: multidrug resistance protein 1
• UniProt Protein Name: Multidrug resistance protein 1
• UniProt Gene Name: ABCB1
• UniProt Synonym Gene Names: MDR1; PGY1
• UniProt Entry Name: MDR1_HUMAN