Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18) Recombinant Protein | ADAMTS18 recombinant protein

Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial

Average rating 0.0
No ratings yet
Gene Names
ADAMTS18; KNO2; ADAMTS21
Purity
Greater than 85% as determined by SDS-PAGE.
Synonyms
A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18); N/A; Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial; ADAMTS21; ADAMTS18 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater than 85% as determined by SDS-PAGE.
Form/Format
Liquid or Lyophilized powder
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8
Sequence Positions
48-650aa; Partial
Sequence
SDSSSGASGLNDDYVFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSSPAGHHPHVLYKRTAEEKIQRYRGYPGSGRNYPGYSPSHIPHASQSRETEYHHRRLQKQHFCGRRKKYAPKPPTEDTYLRFDEYGSSGRPRRSAGKSQKGLNVETLVVADKKMVEKHGKGNVTTYILTVMNMVSGLFKDGTIGSDINVVVVSLILLEQEPGGLLINHHADQSLNSFCQWQSALIGKNGKRHDHAILLTGFDICSWKNEPCDTLGFAPISGMCSKYRSCTINEDTGLGLAFTIAHESGHNFGMIHDGEGNPCRKAEGNIMSPTLTGNNGVFSWSSCSRQYLKKFLSTPQAGCLVDEPKQAGQYKYPDKLPGQIYDADTQCKWQFGAKAKLCSLGFVKDICKSLWCHRVGHRCETKFMPAAEGTVCGLSMWCRQGQCVKFGELGPRPIHGQWSAWSKWSECSRTCGGGVKFQERHCNNPKPQYGGLFCPGSSRIYQLCNINPCNENSLDF
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
References
"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.Sci. Signal. 2:RA46-RA46(2009)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
135,167 Da
NCBI Official Full Name
A disintegrin and metalloproteinase with thrombospondin motifs 18 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase with thrombospondin type 1 motif, 18
NCBI Official Symbol
ADAMTS18
NCBI Official Synonym Symbols
KNO2; ADAMTS21
NCBI Protein Information
A disintegrin and metalloproteinase with thrombospondin motifs 18; disintegrin and metalloprotease-like protein; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18; a disintegrin-like and metalloprotease (reproly
UniProt Protein Name
A disintegrin and metalloproteinase with thrombospondin motifs 18
UniProt Gene Name
ADAMTS18
UniProt Synonym Gene Names
ADAMTS21; ADAM-TS 18; ADAM-TS18; ADAMTS-18
UniProt Entry Name
ATS18_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ADAMTS18 adamts18 (Catalog #AAA279405) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 48-650aa; Partial. The amino acid sequence is listed below: SDSSSGASGL NDDYVFVTPV EVDSAGSYIS HDILHNGRKK RSAQNARSSL HYRFSAFGQE LHLELKPSAI LSSHFIVQVL GKDGASETQK PEVQQCFYQG FIRNDSSSSV AVSTCAGLSG LIRTRKNEFL ISPLPQLLAQ EHNYSSPAGH HPHVLYKRTA EEKIQRYRGY PGSGRNYPGY SPSHIPHASQ SRETEYHHRR LQKQHFCGRR KKYAPKPPTE DTYLRFDEYG SSGRPRRSAG KSQKGLNVET LVVADKKMVE KHGKGNVTTY ILTVMNMVSG LFKDGTIGSD INVVVVSLIL LEQEPGGLLI NHHADQSLNS FCQWQSALIG KNGKRHDHAI LLTGFDICSW KNEPCDTLGF APISGMCSKY RSCTINEDTG LGLAFTIAHE SGHNFGMIHD GEGNPCRKAE GNIMSPTLTG NNGVFSWSSC SRQYLKKFLS TPQAGCLVDE PKQAGQYKYP DKLPGQIYDA DTQCKWQFGA KAKLCSLGFV KDICKSLWCH RVGHRCETKF MPAAEGTVCG LSMWCRQGQC VKFGELGPRP IHGQWSAWSK WSECSRTCGG GVKFQERHCN NPKPQYGGLF CPGSSRIYQL CNINPCNENS LDF. It is sometimes possible for the material contained within the vial of "A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.