Glycogen debranching enzyme (AGL) Recombinant Protein | AGL recombinant protein
Recombinant Human Glycogen debranching enzyme (AGL) , partial
Gene Names
AGL; GDE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycogen debranching enzyme (AGL); N/A; Recombinant Human Glycogen debranching enzyme (AGL) , partial; AGL recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
97-253. Partial
Sequence
QGNEKSGGGYIVVDPILRVGADNHVLPLDCVTLQTFLAKCLGPFDEWESRLRVAKESGYNMIHFTPLQTLGLSRSCYSLANQLELNPDFSRPNRKYTWNDVGQLVEKLKKEWNVICITDVVYNHTAANSKWIQEHPECAYNLVNSPHLKPAWVLDRA
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for AGL recombinant protein
This gene encodes the glycogen debrancher enzyme which is involved in glycogen degradation. This enzyme has two independent catalytic activities which occur at different sites on the protein: a 4-alpha-glucotransferase activity and a amylo-1,6-glucosidase activity. Mutations in this gene are associated with glycogen storage disease although a wide range of enzymatic and clinical variability occurs which may be due to tissue-specific alternative splicing. Alternatively spliced transcripts encoding different isoforms have been described.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
172,696 Da
NCBI Official Full Name
glycogen debranching enzyme isoform 1
NCBI Official Synonym Full Names
amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
NCBI Official Symbol
AGL
NCBI Official Synonym Symbols
GDE
NCBI Protein Information
glycogen debranching enzyme
UniProt Protein Name
Glycogen debranching enzyme
UniProt Gene Name
AGL
UniProt Synonym Gene Names
GDE; Amylo-1,6-glucosidase
Similar Products
Product Notes
The AGL agl (Catalog #AAA113153) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 97-253. Partial. The amino acid sequence is listed below: QGNEKSGGGY IVVDPILRVG ADNHVLPLDC VTLQTFLAKC LGPFDEWESR LRVAKESGYN MIHFTPLQTL GLSRSCYSLA NQLELNPDFS RPNRKYTWND VGQLVEKLKK EWNVICITDV VYNHTAANSK WIQEHPECAY NLVNSPHLKP AWVLDRA. It is sometimes possible for the material contained within the vial of "Glycogen debranching enzyme (AGL), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.